CAZyme Information: ASPTUDRAFT_183446-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_183446-t33_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680	KV878179|CGC4	76987.38	5.5087

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878179:410645-412797(+)

Full Sequence      

MDPANEYCGLEDYGLVGDMHTCALVSKNGSVDSMCWPVFDSPSIFCRILDKEKGGHFSIT
PDRRLKNPLSKQRYRPYTNMLETRWIHEEGVVNILDYFPIAKPKPHVVEKGLPQWCRCYQ
NRGSAQQEACRSGMVRKAECVRGEMEIEIELFPAFNYARDSHIAQQSSASDDGIQVYHFQ
SESQNLVVSVLGDKGDISEDDSDLSIEFELSDRPGHLGPGLIGKVTLKEGQSVTMLLHDQ
ESITCNAQDLAPYLQQIERTTGDFWSDWTSKCTFRGHYREQVERSLLVLKLLTYKPTGAI
VAAPTFSLPEHIGGSRNWDYRYSWVRDAAFTVYVFLKNGYPEEAESYINFIFERIFPPMD
KNPKPGEPFLPIMITIHGEREIPEMELDHLEGYRGSRPVRIGNGAATHIQLDIYGELMDS
IYLYNKHAADISYDQWRAIRRMIDFVIQIRHQPDQSIWEVRGPPQNFVYSKIMLWVALDR
GVRLAEKRSNLPCPDRARWMHERDALYDEIMTKGYNAEKGFFCMSYENQDAMDAAVLIAP
LVFFVAPNDPRLLSTIQKITDVPAKGGLSVANMVSRYDTGKVDDGVGGNEGAFLMVTFWL
VEAMMRAAKSKAYLPHDPFFQQLRKTATSQFDSILSFANHLGMFSEEVATSGEQIGNMPQ
AFSHLACVSAAMNLGGGGDR

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_183446-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	279	671	6.1e-81	0.9916897506925207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225922	SGA1	4.23e-124	11	674	17	604	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
395586	Glyco_hydro_15	5.96e-80	276	671	1	416	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
273702	oligosac_amyl	1.63e-14	284	664	260	603	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16993.1|GH15	0.0	1	680	1	680
BCS05439.1|GH15	0.0	1	680	1	680
CAK41144.1|GH15	0.0	1	667	1	631
QMW26935.1|GH15	0.0	7	677	8	680
QMW39015.1|GH15	0.0	7	677	8	680

PDB Hits     

ASPTUDRAFT_183446-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10211|YAY3_SCHPO	6.31e-189	10	671	19	636	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1
sp|P71741|TREH_MYCTU	1.11e-102	5	674	49	660	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
sp|Q9HLE2|TREH_THEAC	2.00e-100	24	674	2	568	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1
sp|A0R0W9|TREH_MYCS2	5.06e-100	5	674	37	648	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
sp|Q978S7|TREH_THEVO	2.19e-95	7	674	27	610	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_183446-t33_1-p1.