CAZyme Information: ASPTUDRAFT_131941-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_131941-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582		64183.21	5.5211

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878208:1430903-1432811(+)

Full Sequence      

MFSGLLLLLASLVALLSAVGNAAVTIQSSNTTCRCFPGEKCWPSLAEWTQFNESIDGRLI
QTIPLGKPCHTPSYQAGVCDYLREQWTEPEIHYESSSSIMAPWFANGSCDPFHRIAKPCT
LGNYIVYAVNVSQPSHISRALAFATAHNLRVVVRNTGHDYNGKSTGAGALGIWTHHLKDI
DIVDHHDSHYSGKAIRLGAGVQGYEAWEAADAHGYQVVSGECPTVGIAGGYSQGGGHSAL
SSRYGLAADQVLKWEVIDGTGHFITATRDNEYKDLYWALSGGGGGTYGVVWSMTSKIHTG
TPVSGLNLTFTNTNISQDTFYSAVGLYHSLLPAIVDAGAMSIWYFTNTTFYIAPITGPNI
PVQELISLLKPFRDGLEKMGIRYTLYAEQFPTYLAEFNGMMPNIPVGEAQYGGWLIPRSV
VHENNTALTAAYRQITEDGATFIGVGLNVSKALVGDVDNAVLPAWRDTLIDTTLTTPWQW
DARQDMLVQQYKMTYEYLPLLERLAPDSGAYMNEGDFRQPNFQKAFYGVNYPRLRQIKKK
YDPLDVFYAQTAVGSDEWTMYPDGRLCRVSTADDNTDGWEYF

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	131	327	8.2e-41	0.4017467248908297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.94e-22	124	267	3	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	7.53e-17	106	547	10	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.22e-13	510	554	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	2.12e-59	26	568	493	1065
QKD57322.1|CBM91|GH43_11	2.12e-59	26	568	493	1065
UJO23499.1|AA7	1.28e-12	117	547	53	477
UQC87672.1|AA7	2.30e-12	129	555	74	497
SAM83140.1|AA7	2.58e-12	89	548	57	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	4.41e-135	10	569	3	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	7.26e-67	33	568	30	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
2IPI_A	3.64e-14	125	547	58	511	Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_B Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_C Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_D Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus]
4PVK_A	6.04e-14	126	297	54	222	Phl p 4 I153V N158H variant, a glucose oxidase [Phleum pratense],4PWC_A Phl p 4 I153V N158H variant, a glucose oxidase, 3.5 M NaBr soak [Phleum pratense]
4PVH_A	8.00e-14	126	297	54	222	Phl p 4 N158H variant, a glucose dehydrogenase [Phleum pratense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFM2|PATO_ASPCL	1.86e-195	11	569	7	568	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|A0A075TR33|PATO_PENEN	7.11e-190	30	570	25	568	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	3.31e-189	19	568	13	562	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|G0R6T3|SORD_HYPJQ	6.00e-163	22	570	28	574	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|A0A0C6E5D0|BET5_NEOBT	5.80e-141	27	569	26	586	FAD-linked oxidoreductase orf1 OS=Neocamarosporium betae OX=1979465 GN=orf1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999771	CS pos: 22-23. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_131941-t33_1-p1.