CAZyme Information: ASPTUDRAFT_118763-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_118763-t33_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	KV878198|CGC7	46309.80	7.8268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878198:226535-227949(-)

Full Sequence      

MAPTRLRRLAIVALIGAVLMICICQQRTKFDTKPIDLEDQYPLLYRHVHTHNTEGGAWYI
PPKWTSASKSPPKNIVEAAELALSAARASPDGYLPHSTIPMIVHQTWKNARIDTWPQIIR
HSAERWLQTAEGEMAYFLWTDEGMEQFIHHFEPDLESHYAHLARNVERSDAFRIVISKWI
GGVYGDIDTEPLRKPAEWITPTDLHAWNDTRAGTSFNSTAPVRAIVGLEADCPEGSDTYW
RMGYSQPVQLTQWAFAWAPGHPILQTFIDRLSATIGDISNRYGGSLQSRAARQELMNLDP
LTLTGPAAFTDVVRSRLEEVAGLRWHALSGLKDGGKSKLVDDVLILPITGFSPGRGKYGN
MGSKPITDPSARLRHLAQGSWRAFDVKVEYGKFCRTVLGMCRDWSKVPTVAVQ

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_118763-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.93e-19	93	373	76	338	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.37e-06	136	199	20	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93027.1|GT32	2.57e-313	1	413	1	413
BCS05686.1|GT32	2.57e-313	1	413	1	413
CAK38082.1|GT32	8.50e-303	1	413	1	413
ADK37855.1|GT32	5.21e-219	1	386	1	385
QMW48355.1|GT32	1.13e-168	5	410	7	413

PDB Hits     

ASPTUDRAFT_118763-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.35e-24	159	382	202	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.82e-23	100	382	100	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.99e-15	93	382	90	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	9.02e-15	93	352	124	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.512338	0.487665

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_118763-t33_1-p1.