CAZyme Information: ASPTUDRAFT_116987-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_116987-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
943		101600.03	5.6051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878187:3432059-3435151(-)

Full Sequence      

MERKHRWGSSFLLMWLLAAEGVYAAPRQTSSAASSKTQFPPGAETERVLAGTKGFYPTSL
EREGHPVRPTPTSTGKDKDPLGLDGLFDALGDTANLPNELLSEFLPGWDKNFPVTVPVSA
YKPASADSTTSATKSQTEAETSETSTAEAPSQNAPEATTATSQTSSQASSTTSVTQSSSS
SSASQAQPSSSASLTTTASQTTQAENSITSSVVQASVTSMSGQDVFVPLATGPIPQTITA
RNDHPVPKKGIENVTTPIETNKFYAGLFLGSQTNTTFTHPYGVSWAKGSGNAQSYGMAIS
HNEVNVVANGPTNTNIPGNPIQYYINPIGIQHMILSATELNTSTVLTAENLLPFSADAVL
SPTPGSSQRITIPLVQGMGFVTGMYNNLQPLIQSGVFFSKVVTASSPRIGIYKYKVSLAD
GTEWLVYAIPQDGKDPDFRLESNTNFRGPSGWSGTIQITKNPAGASGEKLLDGSSGVFAL
EAAVSGSVLNGAGTYNLAFAKTGKQLQETPLLMYALPHHVESFDNTTKGRMTSISLRTTT
KGNATAVVGETWTMLEPNLPTQMGFDPWTVSSGNVNNLSAAAKQVILSVAPTELNQSIDQ
QSDLNSMYYSGKALSKFATLVYTVNKLGGNPDLAASALQNLKTAFSRFIDNKQQFPLVYD
SVWRGVVSSASYGGDSGADFGNTYYNDHHFHYGYFIHAAAIIGSLDSTWLTDSNKAWVNM
LVRDAGNSAANDPYFPFSRSFDWYHGHSWAKGLFESFDGKDEESTSEDTMFAYALKMWGK
TIGDASMEARGNLMLGILRRSLHNYFLMESDNKNQPANFIANKVTGILFENKVDHTTYFG
NNLEYIQGIHMLPLLPSSPYVRSQNFVREEWNALFSANATDPASNVTGGWKGVLYANLAL
IDPASSWNFFAQSSFDYSWIDGGASRTWYLAFAAGQYIPLKLY

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	242	932	1.3e-231	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	216	935	46	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	577	930	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.83e-149	244	569	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95538.1|GH81	0.0	1	935	1	935
BCS08078.1|GH81	0.0	55	935	10	890
CAK43675.1|GH81	0.0	1	939	1	955
QMW40391.1|GH81	0.0	1	935	1	906
QRD82801.1|GH81	0.0	1	935	1	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.97e-106	218	907	1	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.36e-106	218	907	26	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.61e-103	218	907	1	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.61e-29	608	913	340	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5UPI_A	1.17e-18	608	926	361	674	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	219	937	187	903	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.46e-179	224	936	2	702	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.76e-163	244	943	66	744	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.94e-163	224	935	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.38e-161	235	935	411	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000410	0.999553	CS pos: 24-25. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_116987-t33_1-p1.