CAZyme Information: ASPSYDRAFT_95229-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_95229-t33_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		40632.60	6.7156

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878599:304737-305934(-)

Full Sequence      

MRRTLLFFVVVTLVILFLVTRSVWTLLSLLVEDGASDAIHRAELPWVNSTFVNKRPQTIP
KIIHQTYKNETIPDVWVDAQQSCINLHPDYEYILWTDAKSRQFIAVEYPWFLQTFDGYKY
PIQRADSIRYFVLAHYGGIYIDLDDGCNRSLDPLLAYPAWLRRTVPTGISNDAMGSIPQH
PFFLRVIESLQQYDRHWALPYITVMYSTGPLFLSVIWKEYMKDSQSEEGRVSILMPDEYK
NNSWSFFTHHTGNSWHRKDARLIFWMGQHWQLLTLCGFLAAAAVLVCLFWTYTQVLLLRD
YRHATGSSGLWPSPAQRGRYMIPALLWGQGAKRDEDMETLCELESRDD

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	77	155	6.1e-23	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.60e-74	49	270	72	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.89e-28	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25423.1|GT32	4.63e-214	1	348	1	345
CAP86500.1|GT32	5.03e-180	1	348	1	360
QQK45416.1|GT32	2.80e-179	1	348	1	359
BCS14035.1|GT32	2.80e-179	1	348	1	359
BCS02358.1|GT32	2.80e-179	1	348	1	359

PDB Hits     

ASPSYDRAFT_95229-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	6.32e-103	1	279	1	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.10e-102	1	293	1	297	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.49e-89	48	289	46	288	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.98e-85	59	278	82	304	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	2.65e-56	57	288	62	295	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.626996	0.373009

TMHMM  Annotations     

Start	End
5	27
270	292