CAZyme Information: ASPSYDRAFT_92443-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_92443-t33_1-p1
• CAZy Family: GT45
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	KV878591|CGC1	44499.29	4.3779

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878591:1085118-1086389(+)

Full Sequence      

MLHSLYSSCRALTVQSLALSVLSILALSHAAVINQTLAQNSDGPFNYYRIVALTRLGNGV
VLASFDGRPDGADAPSPNSILQRRSTDNGETWGALTYIAQGRPGSEGVQKYGFSDPSYVV
DSGKGKVFNFHVFSKDQGYPGSVLGNNDTDVDVLSAEVSLSTDGGLSWTTDPDNQPELPP
VASSKVGAPPLITTAIKPVGATVDGVDNVGGVLGAFATSGQGIQLKYGKYAGRLVQPFVG
RVIQADGSTASQAYSVYSDDGGSTWQMGTPVGTGMDENKIVELSNGTVMLNSRPGDGSGY
RKVALSTDGGITYSTPRSETQLPDPGCNGAITRMYPDAEGGSDLARILLFTNANSQESRI
NGTVRYSCDDGYTWSAGKVFSPGATAYSTITALDNDRFGIFYEGLDNELVLLQVDANWLE
VSC

Enzyme Prediction     

EC	3.2.1.18:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	36	405	4.3e-80	0.9327485380116959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	1.46e-85	35	403	1	323	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
226840	NanH	2.85e-35	28	403	252	643	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
404074	BNR_2	6.11e-10	253	400	138	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
404074	BNR_2	0.001	158	376	22	200	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23515.1|GH33	2.89e-274	1	423	1	423
CAT16707.1|GH33|3.2.1.18	1.35e-189	18	423	17	407
CAX30683.1|GH33|3.2.1.18	1.35e-189	18	423	17	407
CAP97302.1|GH33|3.2.1.18	1.35e-189	18	423	17	407
UKA59712.1|GH33	1.66e-158	35	419	38	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	2.79e-107	35	403	12	344	Sialidase [Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1EUT_A	3.44e-104	35	403	12	344	Sialidase, Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	1.22e-103	35	403	8	340	Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	2.43e-103	35	403	8	340	Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]
1W8N_A	3.42e-103	35	403	8	340	Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q02834|NANH_MICVI	5.31e-103	35	403	54	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
sp|P29767|NANH_CLOSE	1.73e-20	46	404	393	810	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
sp|Q99PW3|NEUR1_RAT	2.55e-13	43	399	66	376	Sialidase-1 OS=Rattus norvegicus OX=10116 GN=Neu1 PE=1 SV=1
sp|O35657|NEUR1_MOUSE	6.08e-13	43	399	66	376	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1
sp|P0C6E9|NANH_VIBCH	7.79e-11	255	420	584	773	Sialidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=nanH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000417	0.999545	CS pos: 30-31. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_92443-t33_1-p1.