CAZyme Information: ASPSYDRAFT_91759-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_91759-t33_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	KV878590|CGC3	40439.64	7.4358

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878590:580854-581951(+)

Full Sequence      

MPHLGQKILNKLGVDSHQHGHGPGPPPSEGPPLQGRRMINEDERLLGSHPRGTYPRLAKL
ADGSILSGFTRFEGKTRVLQVARSTDGGYRFEDFSEVTRGAGDVDNMYLLEIAPMTVLAA
FRNHDIGPHGPTHFRITVCRSTDGGKSWHFLSQAAQKSAPLGIWEPFMRMSHRGEVMLTY
SQEFAHNNQCTMLVRSTDGGATWSPPQCLEGEKDPFRDGMNGIAKTWDNGREALVMVFET
TTFGPFDLEALISYDDGYTWGNRHRVYVPKRGHNAGSPQIAAFGDGSMAVIFMNDEDHHQ
VQWTKNASIKVVFGSPPNNGKIQWSRPQVICPHLSHWPGIMAVDDRTLLATYECGGPKAK
SITLH

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_91759-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	50	311	5.4e-71	0.9120521172638436

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	2.13e-10	113	359	22	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	0.003	136	307	20	194	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
271234	Sialidase_non-viral	0.008	47	149	194	294	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24955.1|GH93	1.77e-257	1	365	1	365
EAA62412.1|GH93	7.72e-225	3	364	4	366
QMW42642.1|GH93	7.51e-191	5	365	6	379
QMW30589.1|GH93	7.51e-191	5	365	6	379
QRD89469.1|GH93	7.51e-191	5	365	6	379

PDB Hits     

ASPSYDRAFT_91759-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPSYDRAFT_91759-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999238	0.000771

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_91759-t33_1-p1.