CAZyme Information: ASPSYDRAFT_91437-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_91437-t33_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876		97464.07	9.2630

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878589:954711-957619(+)

Full Sequence      

MFGRDDGDGHGRLQEEVDSGVHLLDNGRVDIDFREHKRHKPWLASRARRVEQTNPQPEAE
EEKHPESQAPEQAPKFPLKLNIVIHVVGSRGDVQPFLVLGKELRKHGHRVRLATHLAFRK
DVLAQDLEFFNIGGDPEQLMAFMVQNPSLLPGVRTIRSGAIRKRRREMKEIFSGCWRSCY
ELGDGTGQYTVPGEPGGEGVDYDYPMKSFVADVIVANPPSFAHLSCAEKLGIPLNIIMPW
SPTQAFPHPLANIQAKNTKPTVANFASYGVVEALTWQGLGDLINRFRKKELGLESLDAAR
APSIAHRLRIPHTYLWSPSLLPKPEDWDSTIDICGFQFLSAESNYKPPRDLETFLEAGPR
PIYIGFGSIVVEKPEELTDILFHAIQRTGQRALISKGWSKVGSGRSDIPENIFLLDPSPH
DWLFQHVSCVVHHGGAGTTAAGLLAGLPTVIIPFFGDQPFWGSIVARAGAGPQPIPFKKL
TTEKLVSAINEALGAETKQKANSIGEQMRREKGAENAVNSFHRHLDVESLRCSICPARPA
VWWLRHSQIKLSTFAASVLLHTGHVRPRDVFLYHSHEHDTYRHPRGPLSAVAEVLYAIGT
DLILAVARAPSRLADLFSRGQEAEINNEYRGREWAMRHFAAECLSYQQQRRGTNGTSLDE
SRPSTVTESGDTPERKPERYNANEDRHYMEVLQSGNRPGAGKRVLRESSYRTRQLALHMA
HYIMLLPTDLSLSICRGFHNVPRLYSDHTVRPIPKVRGIKGGLRAAKKEFTQGFYFGARG
LVTLPSDGFKESGGKGLAKGIGKGLGGAFFKPAAGICGLVGFPLQGVDKNIRRSLSKSKS
KQIIRFRITQGIEEMCDASMEEQESVIPTWHEITGK

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	206	524	1.4e-56	0.7513089005235603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.59e-80	80	524	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	8.23e-43	82	523	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.71e-16	82	247	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
278624	UDPGT	9.00e-09	346	575	259	463	UDP-glucoronosyl and UDP-glucosyl transferase.
273616	MGT	3.30e-08	80	517	1	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK59363.1|GT1	0.0	7	873	34	934
QMW26747.1|GT1	0.0	7	873	34	934
QMW38826.1|GT1	0.0	7	873	34	934
BCS13686.1|GT1	0.0	9	873	26	968
BAE55182.1|GT1	0.0	7	873	34	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	8.79e-70	87	526	27	440	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.46e-69	87	526	47	460	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.09e-26	80	514	1	388	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.01e-23	80	509	1	366	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	4.20e-23	225	504	112	379	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	1.05e-120	80	525	193	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	3.95e-116	79	528	155	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	2.09e-73	81	572	698	1175	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1
sp|A2QNQ5|ATG26_ASPNC	1.29e-70	80	526	897	1315	Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg26 PE=3 SV=2
sp|A7ERM5|ATG26_SCLS1	3.52e-70	74	526	936	1358	Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_91437-t33_1-p1.