CAZyme Information: ASPSYDRAFT_90514-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_90514-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216		21800.72	4.3292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878587:1443537-1444187(+)

Full Sequence      

MNNTSTDGNCGSNSDTNATCLGSTYGDCCSSKGYCGETSAYCSEGCQLEFGECDDGSIQR
ISTTGSCGSTRTSNVTCLGSTYGDCCSSKGYCGGNSSYCGSGCQSTFGSCGLDSTPSPSA
SSSASPSASVVPASDSDGLSKGAIAGISVGAAVGGLAIIALLLWFFIRRRKAIPDSQDEK
TDFKPDVSSGHELNGAQMHEMEAKGPTQAPAELPSH

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	4.02e-08	14	54	4	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	5.46e-08	73	111	6	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	0.001	26	47	14	35	Chitin recognition protein.
395135	Chitin_bind_1	0.004	83	105	14	36	Chitin recognition protein.
240529	MATE_SpoVB_like	0.007	143	173	175	205	Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29742.1|CBM18	3.30e-105	1	216	1	215
EAA61582.1|CBM18	1.47e-55	4	214	6	247
QGI78660.1|CBM18	7.82e-42	4	110	39	146
QGI61474.1|CBM18	7.82e-42	4	110	39	146
CCT65321.1|CBM18	7.82e-42	4	110	39	146

PDB Hits     

ASPSYDRAFT_90514-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPSYDRAFT_90514-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000062

TMHMM  Annotations     

Start	End
144	166