CAZyme Information: ASPSYDRAFT_90322-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_90322-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		66674.26	6.8448

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878587:933206-935197(+)

Full Sequence      

MASSDTPRSAICSLEEFLQMSYDYIIIGGGTAGLAVAAGLSEDPTVNVGVIEAGKDQTQN
EHVSTPALFTRILGVPEYDWMLATVPQKGNRGKVHALTRGKMLGGSSATNGMMYVRGSKQ
DYDDWSAFGKGWSWSSMAPYFRRHEGFDDTPGGGVPSDTNITNYQSKSHGRSGPVQTSFN
NWRTPLERSFIEAGKQASGIAGPRDPGGGDHLGFFSSLTTIDRKVRKGTRSYAATAYLLP
NTRRPNLRVLTEALAMKVILQGNVASGVRIHCAGQTHDIRATREVILSCGTYKSPQILEL
SGIGDPKILAPVGVQCTIPLPGVGASLQDHVLTAAIYELKDGFSSFDSLRHAHNLQEHLD
MYAKESKGILGAATSGMGFLPYSKMVSPEEVERTCQKIFESPGKTPFERKQLEQVAKQLK
SPISGNIQYILMQGTMGVEEVAGDQGKFQKTLNENDRDAFTLVSCVEYPASRGTVHITSS
DPAKNPAVDPAFLSHSADIEVLATALGFSDKIAQSPALKDKVHRRAYPPESVDLHDHASA
SEAVRDFCLTEYHPCGTCAIGQVVDERLKVYGVQGLRVVDASVFPGNVSGNILSTVYAVA
ERAVDLIKEDAARFPSNL

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_90322-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	610	6.7e-171	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.19e-118	19	617	3	541	choline dehydrogenase; Validated
225186	BetA	2.80e-110	20	613	6	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.27e-36	97	330	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.54e-36	469	603	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.40e-20	3	586	37	558	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29957.1|AA3_2	0.0	1	618	1	618
UJO22487.1|AA3_2	2.40e-177	15	608	20	617
BCS21673.1|AA3_2	4.21e-173	1	610	1	614
UJO21990.1|AA3_2	8.16e-173	1	614	2	617
SMQ52591.1|AA3_2	7.34e-172	17	610	32	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.51e-68	22	610	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4YNT_A	1.25e-67	21	611	5	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
3FIM_B	2.18e-67	22	610	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.10e-66	18	610	2	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5ZU3_A	3.28e-55	22	610	7	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	7.85e-155	10	610	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	7.85e-155	10	610	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.85e-152	13	610	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	7.66e-86	15	610	33	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	3.13e-79	21	607	6	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999198	0.000827

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_90322-t33_1-p1.