CAZyme Information: ASPSYDRAFT_89806-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_89806-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		64552.31	6.7109

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878586:1846091-1847836(-)

Full Sequence      

MSVQDNARFDFIVVGGGTAGNIVAARLAENPNAKILVVEAGVANSKDLEDIRTPANAMEL
RDSQYDWAYKTTMVKRDDYERVEKPNTRGKALGGSSSLNYFTWVPGSKGTFDMWEEYGGK
EWTWDPLVPYLRKSATYHDDEKAYSPELKKIGAGGPIPISHSELIPEMQPFRDLLTRAWK
STGQPITENIFDGEMVGLTHSVNSIYKGRRSGSFLAVADKPSITILPEVHSKRLIIDNAD
KTCKGVTVITASGQELNLFANREVIVSQGVFESPKLLMLSGIGPAAELKKHGIPVIVDSL
HVGQHLLDHPGVPFVLRVKDGYGMDDYVLRAHTAQNKQAIQAYQNNHRGPLGSGFLEMVG
FPRIDKYLEKDPQYRQAKASNGGKDPFCPYGQPHFELDFVCLFGSAFQWHYPTPAKGNYI
TVMVDLVRPVSEGGEVTLNSADPLQQPNINLNYFNNDLDIIAIREGVRYAYDVLKNGDGF
KDIIEAEYPWDMPLHDDKLMKRTVLDRSQTSFHPCGTARLSKNIQQGVVDPGLRVHGVKG
LRVIDASVIPVIPDCRIQNSVYMVGEKGADAIKRDHADFYK

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_89806-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	575	1.6e-151	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.09e-83	8	581	5	546	choline dehydrogenase; Validated
225186	BetA	6.03e-83	9	577	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.71e-39	429	567	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.24e-27	2	575	50	579	Protein HOTHEAD
366272	GMC_oxred_N	2.81e-21	88	310	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90169.1|AA3_2	0.0	1	580	1	580
QKX59780.1|AA3_2	0.0	1	580	1	579
QLI67929.1|AA3_2	0.0	1	580	1	579
QKD59313.1|AA3_2	0.0	1	580	1	579
QGI68848.1|AA3_2	0.0	1	581	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	5	580	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	5	580	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	5	580	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	3.28e-70	9	575	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.53e-70	7	575	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A3B1EFP9|STR4_STRTC	1.87e-59	1	573	28	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	2.41e-59	9	572	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	3.79e-59	3	577	35	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|B1Z034|BETA_BURA4	7.37e-59	8	573	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|A9AMZ9|BETA_BURM1	1.97e-58	8	573	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000010

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_89806-t33_1-p1.