CAZyme Information: ASPSYDRAFT_88421-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_88421-t33_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		52079.61	8.9046

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878585:566133-567659(+)

Full Sequence      

MTTALSPKPTAFRAPCLLDPNQPVKSLSIAFWLWKTLLFAVIISCPGLGYDTSSSLLPYQ
SNHAVDVISSVQSKQEYISIPLKFLRWDSIYFVHIGRIGYVFEQEWAFSYTYSNLVNYLS
SFLFPSSDSNGVAGFAVTGVIVSHVAHYLSVLALYRLSINVFGHDTQRQRLVCFLAAALH
IISPAGAFLTAPYMEAPFSLLNITGLYIYSSSHIDLNSGKRALSHVKLLLSGCFFAVATT
VRSNGILSGIPLVFDALSHSYDIVSRRAFWAAGFRLCFVILSGCIAALGFAVPQYFAYTK
FCMDDSFSRPWCQSLVPSIYGWVQAHYWGVGFLRYWTVSNIPLFLLAAPMLLILFLSSFW
AMGADSPASAFSVSLKTISAPSSSPASTLLTRLAVAQIILTAMALTSYHVQIVNRISSGY
PLWYWYLACQALGTSERTLPAAKYNNHFPALVQVMAIYALVQGVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_88421-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	31	473	6.8e-111	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.08e-37	85	473	58	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.52e-17	86	473	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24525.1|GT76	0.0	1	473	1	473
QMW40534.1|GT76	1.40e-169	11	473	6	452
BCS01167.1|GT76	3.56e-169	15	473	13	469
BCS12914.1|GT76	3.56e-169	15	473	13	469
QRD82967.1|GT76	5.65e-169	11	473	6	452

PDB Hits     

ASPSYDRAFT_88421-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	3.56e-163	11	473	6	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	5.64e-141	17	473	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	5.91e-80	21	473	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.47e-77	17	473	3	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.63e-49	26	473	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.942970	0.057036

TMHMM  Annotations     

Start	End
28	50
132	154
171	193
271	293
341	363
388	410
448	470