CAZyme Information: ASPSYDRAFT_87904-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_87904-t33_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		57123.81	4.9100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2773414-2775283(-)

Full Sequence      

MKLLTLVVLLFGLCFQVYATSQYQRLQDLAKADGSYACSKSEPCEIGCCGPVGQKTGKGT
CGFGPDFCAKGCTSSCDRKSECDAGWGKQWSNASACPLNVCCSKFGFCGTTPDFCGGKKV
VSPECDGTSAHKRTIGYYEGWNVDERLCDKMSPENIPLGIYTHINFAFALINPTTFRIAP
MDDKTASRYRSVIALKRRQPALSVWIAIGGWAMNDPGPTQTTFSDLAASEEKQDTFFGSL
VSFVLNNGFDGVDLDWEYPVADDRGGKPKDFDNFVTFIKRLRERLNRLPQQIGLSITLPA
SYWYLRGFDIVHLEPHVDFLNIMTYDIHGVWDGPIESLGQYALAHTNLTEINLALELLWR
NHINPERINLGLGFYGRSFTLSSPDCVKPGCGWSDGGRPGKCTNTSGILSATEVSRILKE
EKGDSFQDKEAAVQIVVFDKDQWVAYDDQETLKMKLEFANKRCLGGTMIWAIDLDDGELI
GALGKAMGKEKEIVLDDLGFDDYITDLGTNKTGELSGT

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	131	477	2.4e-67	0.9459459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.81e-87	133	475	1	334	Glyco_18 domain.
119357	GH18_zymocin_alpha	3.73e-81	133	475	1	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119351	GH18_chitolectin_chitotriosidase	9.75e-81	150	476	17	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	5.59e-74	133	475	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.66e-63	135	475	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02338.1|CBM18|GH18	3.67e-252	23	495	41	511
BCS14016.1|CBM18|GH18	3.67e-252	23	495	41	511
CAK42254.1|CBM18|GH18	1.85e-251	23	511	41	534
QBJ27663.1|CBM18|GH18	2.47e-245	23	477	41	493
QRD82868.1|CBM18|GH18	1.64e-240	21	492	25	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUS_A	6.21e-53	133	476	3	343	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WVF_A	8.71e-52	133	476	3	343	Crystal structure of a mutant insect group III chitinase (CAD2-E647L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVG_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)5 (CAD1-E647L-(GlcNAc)5) from Ostrinia furnacalis [Ostrinia furnacalis]
5WUP_A	9.47e-48	133	476	94	439	Crystal structure of a insect group III chitinase (CAD1) from Ostrinia furnacalis [Ostrinia furnacalis],5WV9_A Crystal structure of a insect group III chitinase complex with (GlcNAc)6 (CAD1-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
6JM7_A	1.48e-47	132	476	4	351	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
5WV8_A	1.28e-46	133	476	94	439	Crystal structure of a mutant insect group III chitinase (CAD1-E217L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVB_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)6 (CAD1-E217L-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	5.73e-52	96	471	332	708	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.26e-44	133	476	23	364	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q6TMG6|CH3L1_SHEEP	3.65e-43	133	476	2	336	Chitinase-3-like protein 1 OS=Ovis aries OX=9940 GN=CHI3L1 PE=1 SV=1
sp|P30922|CH3L1_BOVIN	5.97e-43	133	476	23	358	Chitinase-3-like protein 1 OS=Bos taurus OX=9913 GN=CHI3L1 PE=1 SV=3
sp|Q7YS85|CH3L1_BUBBU	1.15e-42	133	476	23	358	Chitinase-3-like protein 1 OS=Bubalus bubalis OX=89462 GN=CHI3L1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999681	CS pos: 19-20. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_87904-t33_1-p1.