CAZyme Information: ASPSYDRAFT_85361-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_85361-t33_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
942		105787.07	6.1005

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878582:5464225-5467149(-)

Full Sequence      

MVLAERKGPLVNILVAPDEHKGVARAANDLALDFGRIVGVNGTIHQDITPNRHGVPVIVG
TLGTTFINKLVRDGKLDVSAIEGQWESYIQAVIHNPSAGVSHALVIAGSDRRGTIYGIYD
ISETIGVSPWYWWADVSIKQKDAIYLSSPQKRVQASPSIKYRGIFINDEWELMKWSEKNF
PKSSTGGVFTSEFYKLLYELLLRLKANYLWPGMKQYNSFYLDDPRNAVLANEYGIVMGTS
HHEPLTRSYYEQQTLLDGNWDWSLNKENVSEFMEEGVKRSQDWETLYTVGMRGEGDRESP
TLDSTQLEEIVEIQQGMIKDHISKPLEEVGQAWSLYKEVGKYWEAGMNISELVTLMWTDD
NFGNLLRVPIPQETNRTGGAGVYYHVGYVGAPRSYEWISSTQLVKVWEQMHYAYQREARD
IWILNVQDLKGWEAPTSLFLDMAYDISDFQTPESTTAWLKRWARREFGSDTADSVANIYN
SHGRLVMRRKYETFSMSPFAFSTVHYDEASNVLKEWEDLLAKTLETYNSLDPSAKRSFFE
LVLHPVLAGKTVVELYITKHLGDLYKSQQRTSTNRLARQSLQAFNNDAAITAKYHALYNR
KWDGVMSGPHIGYTDNNFPPYNILPNISWIDKADVEGVDILGIAVQGLNVSQHDEPITLR
SVDPYLPPADSRYIDIFTRTNGTFTYTVKANASYISVTNPTGTLTSPGNNSDARAIISVD
WERAPDGLSWVSLTIHRANSTTKHREATAILPVNKTSVPGGFGGHVESNGVVAIEAAHYS
RAESRNGVAYVDIPYYGRTHSGVKLWPVTAPSQTPSTGPRLTYHFYSFSRVSKAQLVLLL
GGTLDLDPTRPLKVAYSLNSRNVDTKRLFPDYEAGALPPDWDTAVIRGGWNLTTEVEVGT
GPQSLDIWLLEPGVVVQRILLDFGGLEGSALGPPESRYVKHR

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	10	633	1.3e-221	0.8421807747489239

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	5.37e-155	156	492	2	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	1.03e-55	764	935	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88449.1|GH115	0.0	12	936	44	986
QMW37650.1|GH115	0.0	12	936	44	986
QMW25565.1|GH115	0.0	12	936	44	986
UCK58010.1|GH115	0.0	12	936	44	986
BAE56340.1|GH115	0.0	12	940	44	1000

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	2.37e-194	10	941	22	939	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	2.02e-134	7	936	22	834	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	2.90e-134	13	937	55	850	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	6.05e-132	7	936	21	833	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	2.12e-127	22	939	31	966	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

ASPSYDRAFT_85361-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_85361-t33_1-p1.