CAZyme Information: ASPSYDRAFT_81268-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_81268-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		94748.35	4.8722

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878593:421328-424030(+)

Full Sequence      

MRPKFEIHHASQLLLCFLALPAIVNASRSQTRLHSGWKFWHSPTTPDDITYSIRPDNQNE
SLVELRDWILPGANAFIADPAKHYEEPESPPDIDIPYVDNDFDDTNWTSVTVPHDWAITG
EFVSTDEVSGGMGRLPVRGVGWYRYSDLFFPASDKNGNHSVFLDVEGIMSYSMVWLNGHL
VGGWPYGYASYRLDLTPYVRYGEENVLAVRAENPQSSQFSRWYPGAGIYRDVWITKVAKT
HVGLYGTDISTRGVSRGRATVDLAVTVDNENKWDADNPSLWGPPPTQKPNMYVAITKLYT
KNQLLDQYSTPFGIRTLAFSPSHGLLVNNERIPIQGVNQHHDLGALGTAYNHRAAARQLE
ILRDLGANAIRTAHNPPAPSLLHLADEMGFLVLDEIFDVWEEPKLDTDFHLIFNDWAEAD
LRSFIRRDRNHPSIVIWSVGNEVPEQVDNQTAAGRIMASLRSITHQEDITSSNPPRPVTA
SLNRPVSNSTMAHNMDAISLNYQGEGIRWGPAYAHLTGNRSPPQYDTFHAEHPTAAPILG
SEIAWSLSSRGSYFFPVSPYLSAPVNDTNGGGNSSAYEISAYEVYSSDAGSTPDRVFLTQ
DEHPFVAGGFVWAGFDYLGEPYPYDDARSAYSGIVDLAGFKKERFWVYQARWRPELAMAK
IVPQHWNWPDRIGKVTPVHVFSSGDEAVLYINGAQQGPKRKRGEGEYRFRWDEVVYQPGE
VRVVVYKDGEAWAEDVVVTTGEPAALRLSVDRSVIDADGEDLAFVTVEVLDSQGNVVPTA
DDEVQFSIANGSGAGVVVATDNGFPADLTSFASSSRKAFHGLALAIVRAEEGVSGNFVVE
ASSGGLRAAEITVTAH

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	661	6.9e-100	0.598404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.72e-52	114	464	57	428	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
408349	Glyco_hydro2_C5	3.74e-42	746	852	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236657	PRK10150	2.29e-35	140	479	64	446	beta-D-glucuronidase; Provisional
236673	ebgA	3.02e-22	82	442	51	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
406696	DUF4982	4.64e-22	673	735	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28623.1|GH2	0.0	1	856	1	894
EAA58410.1|GH2	0.0	28	855	37	886
QKD56624.1|GH2	0.0	13	853	14	889
CBX94573.1|GH2	0.0	20	855	33	902
AEO63777.1|GH2	1.91e-317	5	856	11	897

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	2.49e-160	102	853	49	818	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	3.59e-132	102	853	28	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	3.37e-131	102	846	34	798	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	1.65e-116	102	853	31	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	3.16e-116	102	853	54	874	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	7.55e-156	102	855	66	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	2.56e-81	103	829	71	795	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	8.88e-46	99	789	47	735	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|P77989|BGAL_THEP3	8.62e-43	101	788	26	687	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KPJ7|PLH8_FORAG	5.99e-39	104	701	76	677	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999758	CS pos: 26-27. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_81268-t33_1-p1.