CAZyme Information: ASPSYDRAFT_80202-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_80202-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546	KV878589|CGC8	58930.51	6.3730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878589:1213141-1214838(+)

Full Sequence      

MRFSRVACQAGILAAAGAFASASGLKNDQYDYIVVGGGPAGIITAERFVEAGKNVLLLER
GVGPTVATGANETLPWNRTLTPIDLPGLSADVGSLDVWNEYMCSDTAGMAACVLGGGVTV
NYMVFVHPSQHDFDDNKNWPEGWKWKDIEPAAERLYERNPGTTLPSADGKRYDQGLYSVL
SSFLDKLGWKSVDMIRQPHEKHQVYSYPSWNIQDQVRAGPVRTYLPLAQKSKNFTLRLNS
KVLRVVRSGSQVTGVEVETPSGASEIVSLAPHGRVVLAAGALSTPRLLFNSGIGPKKQIE
TAKKSGIAVPPQQDWINLPVGVGLKDHPIFTITTKTPGNFGIPDYDGIFNGSNTKDISLY
RKGNGLLTQGKHRMIFFSSNELHGHTRYFQGSCAPDEDSVLEIKAYMTHGLTSTGVLGLD
EKQNTIIETSPYMQTRDDILAARMFVQSLIDDFGASDSGFELQTSPNVSEILASPATGNH
YAASAKMGTDDGRKNGTSVVDVNTKVYGTDNLYVVDGSMHPDLPTGNIQTTIMVVAEAAA
ARILAQ

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_80202-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	22	545	8.1e-196	0.9799270072992701

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	9.39e-49	29	533	7	523	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	8.43e-39	31	535	2	478	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	7.23e-28	26	534	2	523	choline dehydrogenase; Validated
366272	GMC_oxred_N	6.04e-22	102	329	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.67e-16	432	535	24	139	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29639.1|AA3_1	0.0	1	546	1	546
QMW45398.1|AA3_1	1.26e-294	1	546	1	539
QRD84961.1|AA3_1	1.26e-294	1	546	1	539
QMW33361.1|AA3_1	1.26e-294	1	546	1	539
UDD61147.1|AA3_1	3.60e-294	1	546	1	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	1.17e-99	29	546	229	766	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
1NAA_A	2.02e-96	30	545	3	536	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	2.32e-96	30	545	8	541	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	1.28e-91	29	545	7	544	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	1.89e-89	29	545	229	766	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	2.94e-93	30	545	235	768	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	7.33e-24	27	544	2	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q9VY01|EO_DROME	1.70e-21	25	544	85	644	Ecdysone oxidase OS=Drosophila melanogaster OX=7227 GN=Eo PE=1 SV=2
sp|Q7MF12|BETA_VIBVY	3.05e-21	29	544	4	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	1.13e-20	27	537	38	601	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.603226	0.396775

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_80202-t33_1-p1.