CAZyme Information: ASPSYDRAFT_76641-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_76641-t33_1-p1
• CAZy Family: PL9|PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		48570.06	6.9595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878583:3326045-3327495(+)

Full Sequence      

MLLPRRCRRLATFAIVLAVLVCWNSLRQTHGTPVRNAQDEHPLLTKYIRGSRVKGGALHL
PKEWTERSPTPVNTILAAAELVRNKTSCDPQAYIDNSNIPRVIHQTWKDENIEAWPQTYR
ESAEKWMQVVEENDIPYLFWDDVGVAQFMRYFEPDFEAEFYTLPSNVERSDVFRILVCKW
IGGVYVDMDTAPIRSPTEWIDQTDLTFWTDHKTQKTYHSSKPVTAIVGIEADTDPERDTY
WRMGYFFPIQLTQWSFAFAPHHPILQIFIDRLRATIRLYTRNRSNQQVLPDSYPGTLDYV
DPVNLTGPIAFTDAVRTYLDTEGDLRWDAVTGLQDGPDGGVSKLVEDVLVLPITGFSPGS
RRFRDMGSKPVTHHTARLYHHAQGSWRKWNLRVEMGKFCRTAFGLCRDWSKVSHGDSWIF

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_76641-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.44e-16	99	289	82	263	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.01e-08	134	205	17	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21129.1|GT32	2.53e-240	1	360	1	362
EAA62973.1|GT32	4.91e-203	1	420	1	416
EAA64740.1|GT32	3.03e-185	16	384	1	365
QMW48355.1|GT32	1.53e-153	3	414	3	412
QMW36299.1|GT32	1.76e-152	3	414	3	412

PDB Hits     

ASPSYDRAFT_76641-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.95e-22	96	387	139	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.74e-21	93	387	93	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.01e-14	93	388	90	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.39e-12	87	189	52	152	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P47124|HOC1_YEAST	1.36e-11	93	357	124	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.953370	0.046645

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_76641-t33_1-p1.