CAZyme Information: ASPSYDRAFT_69145-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_69145-t33_1-p1
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42256.91	5.0670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878587:504784-505932(+)

Full Sequence      

MAGLVNSASRFGVAIFVFLLIFNMYLFNRVIRLNSQNESLEMSLQTSLPTLITSQPEPAT
VTITNTVVATTTVTPDTPNTPGTQAEPNKQKDTGYSAAITPLLAHQASPDFPAKIWHKSG
PNGVTEQVQKYVDTWFNKNPNFRHELLTDDSGDQYVRENYAEWPEVLETYMALTVPILKA
DFLRVLILYADGGIWSDLDVTCEVPVSEWIPEKFTKDTKNPVNVVVGLEFDGWQFASWTV
MVKPHLQHFKAVIEYVVRQLKYQAMDNHVSISALTKPMLTDVVAVTGPQAITMALLRSVS
EETGQEVTKKDIHQLKEPKLLGDILVLPQAAFAALQGGKPTDQGPYLVSHWYSGSWKNDA
GGEEGQNQNQPKATTTTSASSS

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_69145-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	126	212	3.6e-23	0.9777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.05e-20	109	244	80	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.98e-19	126	212	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30122.1|GT32	3.42e-243	1	382	1	382
EAA62114.1|GT32	1.24e-184	1	378	1	379
QQK40626.1|GT32	8.17e-98	99	363	81	341
CAP80736.1|GT32	5.99e-95	107	363	89	341
CAK40793.1|GT32	4.60e-91	112	365	104	352

PDB Hits     

ASPSYDRAFT_69145-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	2.11e-28	99	358	118	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UTR6|OCH1_SCHPO	1.22e-25	110	359	141	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.73e-25	86	359	70	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.17e-13	105	360	90	473	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	9.99e-07	105	203	55	151	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000000

TMHMM  Annotations     

Start	End
7	26