CAZyme Information: ASPSYDRAFT_62815-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_62815-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	KV878601|CGC4	35621.35	6.7705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878601:156692-157639(+)

Full Sequence      

MRKLVVVVVLSLIVFVIHQLSYVDESVLAGQLSESLSIITSCPPDALEPLVSLPPITDSR
IPDTVHQLWKTTNIEDYSTEIKPSRVAWQTMFEPLNYTVKLWTDDDILKLVKDKYSWLLP
TYLGYPHNIQRADIARMLIVHAEGGIYADLDVYPSSAEHIQCLQHLGMQAIFPPTGGTLG
LSNHFFMAEHGSPFLQWVLYEAKRRGHGLALRRIVLPYLQVFWSTGPIMLTAALRKYAWL
YDTLRDDIGLLDEGYSGAVIRHAAGRSWQGVDGRALNYIADHVQMDVILHATACLFIVLG
LIYVVRRYYGRCPTI

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_62815-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.40e-15	61	268	82	279	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.63e-10	96	173	17	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98326.1|GT32	4.96e-141	2	313	9	320
BCS10670.1|GT32	3.75e-131	36	313	13	290
UNI15388.1|GT32	9.38e-129	24	309	13	304
CAP80286.1|GT32	7.09e-113	9	285	70	347
UQC87643.1|GT32	3.47e-105	16	311	25	323

PDB Hits     

ASPSYDRAFT_62815-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	2.16e-27	60	310	63	306	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	6.17e-19	59	282	55	268	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.41e-18	61	303	82	314	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P31755|OCH1_YEAST	5.79e-06	57	151	92	189	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.029536	0.970436	CS pos: 23-24. Pr: 0.8006

TMHMM  Annotations     

Start	End
5	22
283	305