CAZyme Information: ASPSYDRAFT_61447-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_61447-t33_1-p1
• CAZy Family: GH75
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	KV878595|CGC6	54922.67	4.4184

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878595:277305-279008(-)

Full Sequence      

MHVGRLLLFLAPLLVKAQLSGSVGPLTPSSDKSQTKTCNVKDYGAVADKSTDIGPALSSA
WDECSSGGVVYIPPGDYAISTWVKLSGCKACAIQLDGIIYRTGSDGGNMIMVEHSSDFEF
FSSTSKGAIQGYGYEFHAKGSSDGPRILRLYDVSDFSVHDVALVDAPVFHFSLDTCSNGE
VYNMAIRGGDSGGLDGIDVWSENMWIHDVEVTNKDECVTVKSPAKNILVENIYCNWSGGC
AMGSLGTDTDISDIVYRNVYTWKSNQMYMIKSNGGSGTVSNLVLENFIGHGNAYSLDIDS
EWSSMSAVDGDGVELNNVTIRNWKGTEADGAQRGPIKVVCASGVPCTEVTIEDFAMWTES
GDEQTYRCENAFGEGFCLQEGDGSSGYTTTQTASTAPSGYPAPRMPNDLDSAFGTDSEIP
IPTIPTSFYPGATPYSALSGAAASAGSSIPAVSDRARATPAATGSISLSLSSTADPTRVV
SAATSSVPPFPSSPSSLDGDSQLPAESYGHSHHKHHYRAH

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	63	371	2e-53	0.963076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	3.34e-23	145	371	85	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	1.88e-22	37	352	67	404	polygalacturonase ADPG
215540	PLN03010	4.22e-22	39	374	48	392	polygalacturonase
215120	PLN02188	9.01e-22	31	371	30	390	polygalacturonase/glycoside hydrolase family protein
165802	PLN02155	1.58e-17	33	374	23	381	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23384.1|GH28	0.0	1	520	1	520
ABF50898.1|GH28|3.2.1.171	1.40e-297	1	520	1	505
EAA61967.1|GH28|3.2.1.171	1.95e-281	1	520	1	515
QMW46234.1|GH28	3.90e-264	7	465	9	458
QMW34178.1|GH28	3.90e-264	7	465	9	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	5.75e-230	18	440	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1HG8_A	5.59e-09	195	368	167	340	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	2.49e-298	1	520	1	505	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|B8NK45|RHGA_ASPFN	6.93e-265	7	465	9	458	Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgA PE=3 SV=1
sp|Q2U293|RHGA_ASPOR	5.67e-264	7	465	9	458	Probable rhamnogalacturonase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgA PE=3 SV=1
sp|A2QYE5|RHGA_ASPNC	1.49e-249	6	445	7	446	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	1.64e-246	6	445	7	446	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999734	CS pos: 17-18. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_61447-t33_1-p1.