CAZyme Information: ASPSYDRAFT_60431-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_60431-t33_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1017	KV878592|CGC9	112273.77	4.9901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878592:328697-333474(-)

Full Sequence      

MRLWSIVALLAICTTAAAASMEDLAKALPPCALECFINAIPASPCAATNQTCLCTDPGFT
ANVETCVMGACTIRQALTTKNVTYTMCDMPVRDRTILVSGIGLAGVGIAFVVFCLRLIAR
LPCCGGQFGWDDWTMVLTMVCVIPLSALSWVLADDGLGLDMWTVPFDNITHILYVYFWDE
LLYLSAVGLTKISILCFYLRVFPRREVRRLIYVAIGLNVSYVLVFNIITIFQCNPVQGAW
LRWDEEHEFKCNNVNGQVWCSAIFNIILDAMVMALPMRELYMLNLSWRKKAFVMCMFCLG
IFVTLVSVIRLDALIVFANTTNVTWDYVKVGYWSTIEVHVGVICACLPALRSLFRRIWPC
VFGDTQVGTSQGRRTKSTGTGSRNSNSSTAYDYIVVGSGAGGGPLAARLARGGHKVLLID
AGDDQGDALPQQIPAMQLHSTDYEPMRWDFFVNHYDDLSRQEEDSKMVYRTPAGDLHRGS
NPPDNSEPLGILYPRAGTLGGSTTHNAMVTIYPYERDWDDLAALTGNETWKADNMRNYYK
RLEDNRYAPSDIVNHGFGGWLQTSLTQLTLVVEDLKLLSLVIAAGTAMGQNLVGKVLNTV
TGLAGILARDLNTGFSWRDKDEGLFQVPLAVKIPEYKRTGPRDFIMDTIDQGYKLDLQLT
TLVTNVIFDKSGATPRAIGVDYLEGKSLYRADPRSGSASAGTPGKVYAKKEVILSGGTFN
TPQILKLSGIGAKSELAKHNIDTVVDLPGVGKNMQDRYEATLIGKSPTDFTLTTKCTFLE
ETPDPCYEDWKNGVGFKGTYMTNGIAIAIIKKSSVAEHDEPDLLISGAPGNFYGYYPGFP
QECLSDAQHWAWIVLKSRSRNNAGTVELRSTDPRDMPLISFRSFDEGVTTDGADEKDLQA
VYEAMEFSRDIFDNLVPLDGDFTESWPGRDNVTTEKEMKEFIKKEAWGHHACCTAPIGED
GDEMAVLDGDFRVRGVDGLRVVDASVFPKIPGYYIALPIYMVSEKASDVILADAGKW

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_60431-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	390	1012	1.3e-91	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.15e-66	385	1015	2	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.32e-66	391	1011	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.73e-31	858	1006	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.73e-19	377	992	42	558	Protein HOTHEAD
399033	CFEM	1.15e-18	27	88	4	66	CFEM domain. This fungal specific cysteine rich domain is found in some proteins with proposed roles in fungal pathogenesis. The structure of the CFEM domain containing protein 'Surface antigen protein 2' from Candida albicans has been solved.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30671.1|AA3_2	0.0	402	1017	52	667
QMW39616.1|AA3	0.0	402	1015	60	678
QMW27545.1|AA3	0.0	402	1015	60	678
QRD81945.1|AA3	0.0	402	1015	41	659
UDD55433.1|AA3	0.0	402	1015	60	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	1.68e-32	491	1016	85	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.68e-32	491	1016	85	533	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	4.02e-32	491	1016	85	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
4H7U_A	6.79e-30	405	1010	55	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	2.82e-29	491	1013	75	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NE62|CHDH_HUMAN	1.32e-35	491	1017	120	578	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8BJ64|CHDH_MOUSE	5.87e-34	491	1010	122	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	6.04e-34	491	1010	125	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	8.39e-34	491	1011	75	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|B2FQ89|BETA_STRMK	9.54e-34	495	1010	85	535	Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999764	CS pos: 18-19. Pr: 0.9805

TMHMM  Annotations     

Start	End
96	115
136	153
181	203
210	232
291	309
330	352