CAZyme Information: ASPSYDRAFT_60146-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_60146-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	KV878591|CGC10	60157.08	5.1724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878591:527071-528660(+)

Full Sequence      

MPTFRLKTAFPLIALFSIGLFFWCIQRYDREALLRLRHPVDRVGSSGAPQIQLQPTPPTS
NSNLNGNSKQCEVENIMPPLPFNEWLLRKNYTRAYFRPNFLPPKTEFKSLEDISVPVLPP
TTVLERGMVISPANKEDGMACPPVIDVDVAADHDIDETDKLLFGLATSADRLDRLLPSLL
YSYGNTKAGVIVLVPNSDDDIAKQETYFRNRGLDLRLIKSPLDFTARYFGLVQAFAEIIR
TERPQTKWLGWIDDDTFFLSLPTIAHELKLFDVNKKHYIGALSEASWQVDNFGHIAFGGA
GVFVSKPLLDTLVTYYDECQSWGEQPGDQKLGQCIQRFGDTPLTLWPSLYQMDMQGDVDG
VYESGRKIESLHHWNSWYTKDVVKMTSAAAAAGRRSILRRWVFDQEEIINNATGKSIRTF
WVFTNGYSLVKYTYDENTPDDAIDFDHSEKTWEEDPRGYEARLGPLRPKDHPGVTKDRWL
LRETFVVGDDVHQWYVREEDEGHSVIEIVWLGPKGGGGAGVRDFAVNIH

Enzyme Prediction     

EC	2.4.1.-:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	9.06e-10	237	373	202	341	hypothetical protein; Provisional
367085	Fringe	3.64e-04	247	351	86	203	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	0.002	296	373	10	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17583.1|GT31	0.0	1	529	1	527
EAA60099.1|GT31|2.4.1.-	0.0	1	529	1	521
BCS14594.1|GT31	0.0	1	526	1	516
BCS02946.1|GT31	0.0	1	526	12	527
CAK41322.1|GT31	0.0	1	526	1	516

PDB Hits     

ASPSYDRAFT_60146-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPSYDRAFT_60146-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_60146-t33_1-p1.