CAZyme Information: ASPSYDRAFT_59085-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_59085-t33_1-p1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	KV878588|CGC8	66182.87	5.3615

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878588:740975-742882(+)

Full Sequence      

MADIDTDSVVGVHDSSFDFVIVGGGTSGLVVANRLTEDPNVRVLVLEAGTNRLNDPRITI
PGLAPTTFEDPDFDWNFRSTPQEQLNGRRILGNKGRTLGGSSTINLGMVVYPSRTGMNGW
EALGNPGWGWEGFEQYVRRFHTGTPPTDSVRSFFAGMKSEKEDQGASGPVQVSFGDEYMP
YHGAWLRAFESLGWPQTEDPIKGAGVGPFVTPGAIDPATRTRSHAAAAYLTADVTKRTNL
RIMTGARVDKIAFDGSDAGPATARSIKFTKDGQTFTVSASREVILAAGTTQTPQLLELSG
IGNASLLRSHGIQPLVDLAGVGENLQDHGIVSFGYEVADGMPSGDMARDPAVAAAAMAAY
QKDGSGPLGMVPLVSAFMPCVDFPGDKREHLLQTIDSSLDDPKLPVTYRKQYSILREMLK
DPNEPTAQYILAPFQLLPRAGPNANDIFGMSHPGNFISIVSLLSHPLSRGSVHVSSADPA
AAPAIDSGILRHPADVELQARHSIWMEKITETEAMAQLLKPGGQRLHAPDKVAELEKAQD
LCKELVLSMYHVSGTCAMMPREDGGVVDPRLKVYGTSNLRVVDASLFPLVPRGNIQATVF
AVAEKAADIIKEDLARS

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_59085-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	613	3.3e-177	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.72e-82	13	613	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.79e-80	13	617	2	540	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.76e-33	86	328	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.83e-30	466	606	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.31e-24	14	599	53	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27275.1|AA3_2	0.0	1	617	1	620
QGA17771.1|AA3_2	3.76e-214	1	613	1	611
BCS13057.1|AA3_2	1.51e-212	17	613	16	613
BCS01313.1|AA3_2	1.51e-212	17	613	16	613
CAK40027.1|AA3_2	5.87e-212	17	613	15	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	8.85e-79	13	613	2	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	2.69e-71	15	613	4	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.11e-62	17	613	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.22e-62	15	613	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	5.13e-61	17	613	36	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	5.98e-90	6	613	3	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	5.98e-90	6	613	3	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.43e-85	14	613	11	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.79e-81	15	614	38	633	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	5.49e-75	16	610	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000009

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_59085-t33_1-p1.