CAZyme Information: ASPSYDRAFT_57029-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_57029-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		57261.31	5.1244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878585:380495-382012(-)

Full Sequence      

MAMQQLRLLFHHLFQHRTKLQVGSWKLLVSAASFLLACLILITYSATASSRRISASDLFF
DADNENGHSSDRDRDSNNACSVDLNLLRVLADNSTTVDYSRLNIGVLRTDNFTVFEEILD
VSIPSYRTVHLDTGASREIRTEEDCTTSVVIHAPIAAPPPDASHMIFGVATSLEKLEDSL
DAFAHWASNTQAQIVAVVEQGGSSARSRIQERASELGIRLTITQTEDDRFDRYFSLVHLL
YQNLEEESTRWAVLMDDDTFFPSMRNLIHRLDSYDSTIPQYIGGMTEDLARLSGSGYMAY
GGAGIFLSIPLLHDLQYYYETCNSLKDKGDRMLSSCIYSHTDAKFTWERGLHQLDIHGDA
SGFFESGRPLPLSVHHWRSWFQADMVALGKVADICGDECLLRRFHLSKSKDWFLVNGFSV
IQDATLWNDPRPMEQTWEKSKYKGSDPFAYSLGPLRRQDPDKVSFRLRDVVQETDRGQVR
QIYMLNATDENPPQVLEVAWTVVQE

Enzyme Prediction     

EC	2.4.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	7.84e-14	250	376	212	341	hypothetical protein; Provisional
398362	DUF604	2.99e-10	298	376	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	1.87e-04	214	323	49	167	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24596.1|GT31	0.0	1	505	1	505
EAA62756.1|GT31	2.42e-252	1	505	1	526
QMW36933.1|GT31	2.12e-179	76	502	54	469
QRD89155.1|GT31	3.01e-179	76	502	54	469
BAE54694.1|GT31	3.01e-179	76	502	54	469

PDB Hits     

ASPSYDRAFT_57029-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPSYDRAFT_57029-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000021

TMHMM  Annotations     

Start	End
27	49