CAZyme Information: ASPSYDRAFT_56739-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_56739-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
187	KV878584|CGC24	19989.28	4.1265

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2944917-2945588(-)

Full Sequence      

MVFSTTKFLALAATIPSLTLAACPGPDVNDATLDLMKSYEGWEADIYDDGYGNPTVGYGH
LCDDSKCSDVKYDIPLSESDGLKLFADDITSYQDGVASALKSSVKLNDNQYGALVSWCFN
VGAGAVQSSSLVERLNAGESPNTVAEEELPKWKLANGEVSEGLLKRRKAEVKLFQTSSET
SALPADC

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_56739-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	28	170	1.7e-37	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	9.83e-52	33	175	2	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	6.55e-29	28	177	7	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
381620	lyz_P1	5.20e-27	28	170	2	135	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	5.83e-25	35	170	11	137	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
395766	Phage_lysozyme	5.18e-10	54	168	2	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23042.1|GH24	8.62e-126	1	187	1	187
EAA63017.1|GH24	2.78e-92	4	187	3	186
BCS18335.1|GH24	6.22e-65	11	187	8	184
QMW42435.1|GH24	2.44e-64	4	187	3	183
QMW30363.1|GH24	2.44e-64	4	187	3	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	2.75e-17	25	174	49	193	Chain A, Lysozyme [Acinetobacter baumannii]
7M5I_A	5.85e-14	33	177	14	156	Chain A, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
2ANV_A	9.45e-10	36	174	12	144	Chain A, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
6H9D_A	3.71e-09	28	176	6	148	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
3HDF_A	5.53e-06	25	170	2	131	Chain A, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11187|ENLYS_BPPH2	5.01e-21	28	178	3	146	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|P07540|ENLYS_BPPZA	1.91e-20	28	178	3	146	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|Q37896|ENLYS_BPB03	1.53e-19	27	176	2	144	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
sp|Q9T1T5|ENLYS_BPAPS	6.39e-12	28	177	3	146	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
sp|P09963|ENLYS_BPP22	2.52e-09	36	174	12	144	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004591	0.995411	CS pos: 22-23. Pr: 0.6256

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_56739-t33_1-p1.