CAZyme Information: ASPSYDRAFT_56687-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_56687-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		37308.10	5.6449

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2791266-2792409(+)

Full Sequence      

MALSSEPRPKKVWASLITNLSYLPGLLTLHQSLRRTQTAYPFVALYTPTFPESGLSALTA
REIRTLAVPAIKPATTDRKYDADPRFAETWNKLVVFSLEDVFDRVVLLDGDMLVRRNMDE
LMEIPLDGDADEHEDGEEDEHDGLGSGRRVFAASHACACNPMKKAHYPAHWTPQNCAFTT
QHRTPTIAQSTGAPSTAGVGMLNSGLLVVKPSLATFGAIETLLNKPEKVNNYTFPDQELL
SEAFRGRWVPLPYVYNALKTMRAEDVHGAIWRDGEVKNVHYIFAVKPWQEKPPSKEGEKQ
GERDVLNEWWWEANWERQRGERERGIEDGY

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_56687-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	15	290	1.1e-38	0.8638132295719845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.53e-60	12	311	2	235	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	1.32e-13	22	312	35	289	galactinol synthase
279798	Glyco_transf_8	3.84e-11	15	288	3	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
132996	Glyco_transf_8	1.19e-08	14	288	4	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133064	GT8_GNT1	1.32e-08	17	125	7	115	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22968.1|GT8	2.49e-228	1	330	1	330
EAA63208.1|GT8	4.02e-137	1	330	1	292
QRD94212.1|GT8	7.23e-133	6	330	4	312
BAE63310.1|GT8	7.23e-133	6	330	4	312
QMW46104.1|GT8	7.23e-133	6	330	4	312

PDB Hits     

ASPSYDRAFT_56687-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q947G8|GOLS1_SOLLC	7.21e-10	19	310	29	275	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999945	0.000071

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_56687-t33_1-p1.