CAZyme Information: ASPSYDRAFT_565241-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_565241-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	KV878599|CGC6	42724.67	4.8335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878599:546648-547891(+)

Full Sequence      

MGVLSIAKSALLLATAANAANYTEWLAQSYFSKGVTFSRNYAYAVLYTGVEYAYNKTGDA
AYFNYIKTQLDGVLNDDGSFVDPITDTLSLDDIRIGSNFLYLWTVTGDEKYKIAADGLRK
QLDFTPRNQDGGFWHRKPTYPNQMWLDGIYMASNYYAQYTSWFQPDNKTAWDDIILQYDL
IEEHTRDNKTGLLFHGYDASGVAVWADPVTGAAPHIWDRAVGWYFVSLVEVLDYFPKTHP
GYKRTLQRFQSLAKAIKKSQDASGGWWLIMDPQYTSDPRNYIESSASAMFTYALLRGIRK
GFIPANEYSEVAQSGYSLLKNEFLSRNANGTLNWEGTVEVGSLSSNGSFEYYVSVPLVQN
DYKGAGPFIYASYELEAY

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_565241-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	34	376	2.3e-98	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	5.97e-77	41	376	29	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	6.01e-77	41	376	36	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25556.1|GH105	2.49e-275	1	378	1	378
EAA66450.1|GH105	2.69e-254	1	378	1	378
UDD63694.1|GH105	2.53e-185	10	378	6	378
QMW46792.1|GH105	1.03e-184	10	378	6	378
QMW34727.1|GH105	4.17e-184	10	378	6	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.47e-79	22	376	4	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.31e-57	40	376	40	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.40e-56	40	376	30	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	2.46e-18	21	374	62	409	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4Q88_A	7.33e-12	111	324	111	312	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.70e-56	40	376	40	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	4.21e-24	172	371	20	224	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	4.21e-24	172	371	20	224	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000420	0.999562	CS pos: 19-20. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_565241-t33_1-p1.