CAZyme Information: ASPSYDRAFT_56008-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_56008-t33_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722	KV878584|CGC10	78596.68	4.1678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:351178-354114(-)

Full Sequence      

MSANTKSSAFTAIPILDYSQTSARDTKPDFLADLRNALVNVGFFYLVNAPIASEIRQDLV
QKCKALFDLPLEKKLEIEMVNSRHFLGYSRLGAEITARKQDYREQFDFATELPEPGPDEP
LYRNIRGPNQWPDENAIPGFRQSVEAYLAELSPVADNFQILIAEALDLDPAALKQFFDDP
VQQKMKLIKYPPPPSDAESQGVGAHKDSEFLTFLLQATPHRGLEVQNKAGKWVSAPPMDG
SLVVNIGRALEAITGGVCTATTHRVNLAPSNYVDAHGTPLGPRFSIPVFQGMSLDLSVDD
INLEFPAHIKELVGDEKARSDAEATFNKIFSGRTGEGTLIHRIISHQDVGRRWYPELLAQ
ALGESLWVIAAFLRAILAADIYVSPDGSDDAAGTIDAPFQSIQLAVDEATNGSTIYLRAG
TYTPTTNIQISKSGTSSAPFVLRAYEGEAVIIDGEELPGTPAEVGGSLDNEDRGILHIQD
AEYWEFYDLELINGPYGVYARDASNNHYERIITRDNYETGFQLEGESANNVVLYLDSYGN
RDPRKNGESADGFALTIEDTISWGNGFNRWDFSPFEGDGNGFKLGGGDDADIGPANHVIT
NSIAFSNSHDGFTDNSQPGNFELSRNTAWNNSAIGFRFGTAVATLTGNIAASNGEKPTSL
SEEQVSEGNSWDGDGAWDDGSFVSVDVELVQGERNADGTIEASDFLLPSDAEEIGATTDW
SA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	378	555	4.7e-69	0.4755043227665706
PL9	555	708	9.7e-55	0.4265129682997118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226022	PcbC	4.13e-72	11	349	4	322	Isopenicillin N synthase and related dioxygenases [Secondary metabolites biosynthesis, transport and catabolism].
215267	PLN02485	9.84e-40	7	269	2	275	oxidoreductase
140299	PTZ00273	1.47e-38	11	289	4	272	oxidase reductase; Provisional
404995	DIOX_N	2.06e-38	13	134	1	118	non-haem dioxygenase in morphine synthesis N-terminal. This is the highly conserved N-terminal region of proteins with 2-oxoglutarate/Fe(II)-dependent dioxygenase activity.
178579	PLN03002	2.46e-30	31	289	29	281	oxidoreductase, 2OG-Fe(II) oxygenase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21969.1|PL9_3	3.81e-244	362	722	1	393
EAA64642.1|PL9_3	1.52e-218	362	722	2	410
QMW39170.1|PL9_3	1.07e-193	366	720	6	392
QMW27106.1|PL9_3	1.07e-193	366	720	6	392
UDD54928.1|PL9_3	1.07e-193	366	720	6	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RU4_A	1.76e-31	382	718	18	380	Chain A, Pectate lyase [Dickeya chrysanthemi]
6JYV_A	2.60e-23	12	289	10	279	Structure of an isopenicillin N synthase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1],6JYV_B Structure of an isopenicillin N synthase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1]
6XJJ_A	2.23e-21	13	302	41	330	Chain A, 2-oxoglutarate-dependent dioxygenase tropC [Talaromyces stipitatus ATCC 10500]
5TCV_A	6.44e-15	34	265	24	236	ACC oxidase complex with substrate 1-aminocyclopropane-1-carboxylic acid [Petunia x hybrida],5TCW_A ACC oxidase complex with nickel and acetate [Petunia x hybrida]
5GJ9_A	1.29e-14	14	265	8	239	Crystal structure of Arabidopsis thaliana ACO2 in complex with POA [Arabidopsis thaliana],5GJ9_B Crystal structure of Arabidopsis thaliana ACO2 in complex with POA [Arabidopsis thaliana],5GJA_A Crystal structure of Arabidopsis thaliana ACO2 in complex with 2-PA [Arabidopsis thaliana],5GJA_B Crystal structure of Arabidopsis thaliana ACO2 in complex with 2-PA [Arabidopsis thaliana],5GJA_C Crystal structure of Arabidopsis thaliana ACO2 in complex with 2-PA [Arabidopsis thaliana],5GJA_D Crystal structure of Arabidopsis thaliana ACO2 in complex with 2-PA [Arabidopsis thaliana],5GJA_E Crystal structure of Arabidopsis thaliana ACO2 in complex with 2-PA [Arabidopsis thaliana],5GJA_F Crystal structure of Arabidopsis thaliana ACO2 in complex with 2-PA [Arabidopsis thaliana],5GJA_G Crystal structure of Arabidopsis thaliana ACO2 in complex with 2-PA [Arabidopsis thaliana],5GJA_H Crystal structure of Arabidopsis thaliana ACO2 in complex with 2-PA [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1R9B5|GRA15_GIBZE	5.36e-107	8	361	3	360	2-oxoglutarate-dependent dioxygenase FGSG_00048 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FG00048 PE=3 SV=1
sp|A0A0S6XHQ0|FRBJ_BLOB1	1.40e-94	9	359	2	349	2-oxoglutarate-dependent dioxygenase frbJ OS=Fungal sp. (strain No.11243) OX=1603295 GN=frbJ PE=1 SV=1
sp|P0C1A7|PLYL_DICD3	1.35e-30	382	718	43	405	Pectate lyase L OS=Dickeya dadantii (strain 3937) OX=198628 GN=pelL PE=1 SV=1
sp|P0C1A6|PLYL_DICCH	1.49e-29	382	718	43	405	Pectate lyase L OS=Dickeya chrysanthemi OX=556 GN=pelL PE=3 SV=1
sp|Q84MB6|DIOX2_ARATH	1.43e-26	10	265	5	270	Probable 2-oxoglutarate-dependent dioxygenase At3g50210 OS=Arabidopsis thaliana OX=3702 GN=At3g50210 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_56008-t33_1-p1.