CAZyme Information: ASPSYDRAFT_55411-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_55411-t33_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	KV878583|CGC6	36774.93	6.8973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878583:2349339-2350376(-)

Full Sequence      

MKSFLLTCTLLASSALGHIQMSKPFPIRSPLNKDADGQKDYSYTNPLSGSGSDFPCKGYA
NDPFKSMADYKPGQEYEIELQGSATHNGGSCQISLSYDKGKTFRVIHSMIGGCPLTDKYK
FKVPSDAPSGEALLAWSWFNKVGNREMYMNCAQVTVGSDTSRMEGFSAVSKANAFDSLPE
MFVANVNGPGKCKTIEGKDVNFPQPGPSVEGEAEGKGYECEGDAPFLRKANIASSSSASA
SASASPSPSPSRAHGVAASSSAAASSSGAAEASRVAHAAFGQETSAGRFDHPTPQHRHCR
YDDEYICSADHFSFFRCVHGHPVFMGPVAAGTWCVNGHIERAPWF

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_55411-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	18	213	2.9e-70	0.9738219895287958

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410622	LPMO_AA9	0.006	117	161	127	176	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS18639.1|AA11	3.19e-205	1	345	1	339
QMW41394.1|AA11	8.78e-134	1	341	1	344
QMW29322.1|AA11	8.78e-134	1	341	1	344
QRD85645.1|AA11	8.78e-134	1	341	1	344
BAE59063.1|AA11	8.78e-134	1	341	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	5.81e-37	18	222	1	212	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

ASPSYDRAFT_55411-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000781	0.999185	CS pos: 17-18. Pr: 0.9510

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_55411-t33_1-p1.