CAZyme Information: ASPSYDRAFT_54176-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_54176-t33_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		41052.76	6.3967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878582:3888998-3890312(-)

Full Sequence      

MKTFFYTLLALSFRAVTAQVKGTPSGFAAGTTGGGSATPATPSSLAQLKEWITDSTARVI
LIDRTWDFTGSEGTTSGQCCSTRTTVCSGGTSAGQAWIQDTCTDGTWVACTYDNAARTPL
DVGSNKSIVGVGSAGVIKGKGLRIRGGNKNVIIQNIHITNLNPQYVWGGDAITLDGADYV
WIDHNKISLIGRQMIVSGWGTAGHVTISNNEFDGRTSWSSGCNGKHYWTLLLIGLKDWYT
FSNNYLHDLSGRAPHIGTDYTDSKIFLHAVNNYFKDIGGHAFDIDTNTWSLLEGNYFDSV
TTPLTPDSLTSGALIYDVATVAAAGNCAGQLGYICEWNRLSNSGTWTDRTDAAVLSQAAS
YQGSLIGHIGVADVPSTVVANAGVGKI

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	110	298	1e-85	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	4.00e-42	111	300	3	189	Amb_all domain.
226384	PelB	9.24e-20	104	387	82	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.49e-16	105	297	15	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS20248.1|PL1_4	8.28e-212	2	387	3	387
UPL00849.1|PL1_4	1.04e-203	8	387	8	389
UDD64891.1|PL1_4	3.70e-202	18	387	20	391
QMW47813.1|PL1_4	2.14e-201	18	387	20	391
QRD93342.1|PL1_4	2.14e-201	18	387	20	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.20e-83	20	387	3	359	Pectin Lyase A [Aspergillus niger]
1QCX_A	2.39e-83	18	386	1	359	Pectin Lyase B [Aspergillus niger]
1IDJ_A	1.34e-82	20	387	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	9.34e-15	111	300	57	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.87e-07	113	297	69	276	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CFF7|PELF1_ASPTN	4.11e-224	5	387	6	388	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|A1DEH0|PELF_NEOFI	4.95e-213	1	387	1	386	Probable pectin lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelF PE=3 SV=1
sp|B0Y0L8|PELF_ASPFC	7.03e-213	18	387	16	386	Probable pectin lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelE PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	3.54e-115	20	387	23	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5B3J8|PELF_EMENI	3.58e-111	10	387	12	378	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999720	CS pos: 18-19. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_54176-t33_1-p1.