CAZyme Information: ASPSYDRAFT_51590-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_51590-t33_1-p1
• CAZy Family: GH4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	KV878599|CGC4	42563.72	4.1038

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878599:426870-428155(-)

Full Sequence      

MFFPLLSLSTIALSTGTAAAPAPDKALSRAVSAANTLQSWYNGATGIWDTCGWWNGANCM
TTLANLAALDLDDGARDIAEGVFQNTFAVAPNVNPYPERSAAVKYTSKNGKAFDQQQGDE
GKVPTGAANASLWLDGSYDDDAWWGLAWVAAYDVTGQRDYLDLAEGLFYHLSNSWPSKCG
NGGIDSDSTHVYVGAIANELFLALAAGLANRADDSEYYLDWAKRQWAWFSDSGLINDRHT
INDGLMDDCTNNGDTVWTYNQGVILGGLVELYRATGEDDASNSTYLDEAAKIAKGAIAEL
TDDDHVVREPCEPDDCGADQTQFKGAFIRNLRALHAVAPDDAYARVIKASAESLWRNDRI
DGDKLGVDWSGPVDGDKVDASTHSSAMDALVAAIRA

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_51590-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	393	1.1e-93	0.9245810055865922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.40e-30	127	376	77	338	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	3.25e-12	138	369	92	323	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25494.1|GH76	2.80e-274	1	395	1	394
EAA58494.1|GH76	8.09e-200	1	394	1	383
QMW31905.1|GH76	9.59e-163	22	394	20	372
QRD90972.1|GH76	9.59e-163	22	394	20	372
QMW43938.1|GH76	9.59e-163	22	394	20	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	2.75e-20	129	390	82	334	Chain A, Lin0763 protein [Listeria innocua]
6SHD_A	1.87e-16	139	385	135	378	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6SHM_A	2.01e-15	143	385	140	379	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.01e-15	143	385	140	379	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
4BOK_A	1.52e-14	133	307	83	252	Chain A, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05031|DFG5_YEAST	2.20e-17	139	369	122	367	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000639	0.999331	CS pos: 19-20. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_51590-t33_1-p1.