CAZyme Information: ASPSYDRAFT_51043-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_51043-t33_1-p1
• CAZy Family: GH37
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618	KV878597|CGC4	66106.31	4.8237

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878597:599925-601901(-)

Full Sequence      

MTRLDSNGQASPASSVEEFTQTAFDFIICGGGTAGCAIAARLSEDPNVTVGIVEAGKYRI
DDPAIDTPAGFFQTFENPEYDWCLYTAPQTANNGRVHHMPRGKVLGGSSAINYMMYVRGS
LQDYDDWAELAGDEGWSAASMKEYMRKHQTLESVNTAIVDAPSPLVAENHGTTGPIRTSF
NDAYLPIDHEIVKAAAETTSLPNKPVDAWSGDHIGFYHSLGAIARSGPNAGKRSYAGREY
YDANSSRPNLKLLCEARVNRVLLDGTRATGVSITLDGEEYTVSATREVIICGGTIQSPQI
LELSGIGDPAILAAAGVECKVENPAVGANVQDHSLSLIIWDLHPGVVSLDTLYQVPEAME
GAVKQYAETGTGPLSAVSGTQGFFPAKRILSESELAEVIQSIRDIKPTTPFHEKQLQLVI
AHLESDISANMQFVFLPATFNAKDGLEHQSKLLSPPGPGQPAGASAALCIQYPVSRGYIH
IQSNDPAQPPTIQPNYITQEADITLIAAFLRWADKVGLAPSVSSSIAKRTFPRPGLDLQD
LSQAKQAVREVVAGEYHICGSVAMGDALDSNLRVKGVQGLRVADASVFPNNVSGNIMSSV
YAVAERAADLVKRDYGLV

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_51043-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	613	6.2e-165	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.41e-111	20	612	2	532	choline dehydrogenase; Validated
225186	BetA	6.87e-103	24	614	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	2.12e-50	25	611	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.55e-34	93	333	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	6.40e-33	473	607	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21673.1|AA3_2	0.0	1	618	1	618
UKZ78676.1|AA3_2	7.08e-313	11	617	12	618
QQK46529.1|AA3_2	2.98e-286	11	617	4	611
UKZ52878.1|AA3	1.01e-278	11	617	12	596
UJO22487.1|AA3_2	5.38e-233	7	615	8	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.12e-66	24	614	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.60e-65	24	614	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	1.77e-61	22	614	4	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	3.75e-59	24	617	6	588	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6YS2_AAA	3.69e-58	24	611	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	2.50e-153	16	616	6	613	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.50e-153	16	616	6	613	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.45e-147	12	615	2	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	7.39e-79	7	614	27	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.68e-69	24	611	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999396	0.000666

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_51043-t33_1-p1.