CAZyme Information: ASPSYDRAFT_49844-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_49844-t33_1-p1
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455		50057.04	4.2858

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878594:741951-743508(+)

Full Sequence      

MRLAFLATWLASIGRISALEIQLDDHQSIKDAAGKTAKGALGWYAGDEPGGEPGAFPEKW
WEGSALFMSLIIYWFYAGDDQYNDLIIAGMQQQAGDQGDYLPAKYKSYLGNDDQFFWGVT
AMLCAEYGFPESKDGFSWLSLAQGVFNTQKEEWDDTTCGGGLRWQMQPYQSGYTMKNSIS
NGGFFQIAARLALYTQNDTYAEWAQKTWDWSVSSPLVNNKTWNVADSTDINNDCSTQGNN
QWSYNYGAYLTGAAYMYNYTEKAEWKKVVDGLLGKILTDFFPQKMGGGKIFSEYLCEPSG
LCNYNEILFKGVVSHWLTLVALIVPETYDKIFPKLQTSAQAAAQSCSGSGNNTCGIKWYT
EKWDGTIGMEQQIIATDILGSVLVSEKRTPPLNTNTGGDSKSNPNAGTEDDNSNPAELKP
VTTGDRAGAGILTVLFVGAWGAMIAWMVLGEPLIG

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_49844-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	24	387	4.1e-95	0.9441340782122905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	8.61e-164	28	375	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.80e-05	151	387	126	352	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28287.1|GH76	0.0	1	455	1	454
EAA67043.1|GH76	9.77e-263	1	453	1	452
BAE65580.1|GH76	1.81e-212	10	451	15	456
UDD65266.1|GH76	7.33e-212	10	451	15	456
QRD92992.1|GH76	4.37e-211	10	451	65	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.29e-91	22	426	29	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	1.89e-105	1	448	1	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	5.21e-100	17	448	20	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	5.71e-100	18	449	18	452	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	9.66e-95	10	449	15	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	1.05e-94	6	407	9	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.096602	0.903348	CS pos: 18-19. Pr: 0.8646

TMHMM  Annotations     

Start	End
428	450