CAZyme Information: ASPSYDRAFT_49778-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_49778-t33_1-p1
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		75519.20	4.0834

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878594:556262-558295(-)

Full Sequence      

MKPNNILLPLLGALPVATCLNATSLTSEYFGNDAPWYTSRIPLFETSNEALQEVYYYRWS
LFRAHQRDLGSLGFLSTEFINDVSWQVSPWAILINAANYHLREGRWCRDRRFKEDYADVL
FGPNTDPRQFSEVMADGVWQGYLVDGVKEDAVARLEAMKTVYEGWNATLDFGGFDTSKGL
YYIQPLTDATEYTIASIDASGGYDGFDGGNAFRPSINSYQYANALAISNLASLTGDQDTA
DEYLNKATEIKGLVQEYLWNADFTHFIDRFYVDNENVSYWDPIRGRELVGYIPWTHDLPD
DEESYAQAWAHLIDSEKLAGEKGLRTNEPSYEYYMRQYRYEGENPECQWNGPAWPYQTTQ
ALTALANLLDHYPVSAGAGVISKADYNRILVQYANLHYNPNYSGKLNIEEDYYPDTGAPI
VGLARSPHYFHSGFIDQVISGFVGIRPSAEDILEVNPLADPESVSFFRIENVLYHGHDVA
VQWDADGSQYGSAGLQVEVDGDVVATADALSRVTVDVSRADPPAVERPIAKSIQLGADTE
YPVGSVSVSDADSADIHAVIDGRVWFYPEIANWWDTPAGSGEEIWYAVDFGSDAEVTRAE
IAFAKDEDSGVDAPGEYRVQYANGDEWVDVVVEGDYGEAVANGITDVSWDAVATGSVRLV
FTPKDGVKVRLVEFKIF

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_49778-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH142	32	511	1.8e-156	0.9603340292275574

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225942	GDB1	0.003	188	358	385	541	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
183934	treF	0.009	216	262	351	397	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28210.1|GH142	0.0	1	633	1	632
QMW48567.1|GH142	0.0	17	677	16	677
QRD92448.1|GH142	0.0	17	677	33	694
QMW36512.1|GH142	0.0	17	677	16	677
UDD65800.1|GH142	0.0	17	677	16	677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQS_A	3.46e-68	36	512	653	1100	Sialidase BT_1020 [Bacteroides thetaiotaomicron]
5MQR_A	6.47e-66	36	512	653	1100	Sialidase BT_1020 [Bacteroides thetaiotaomicron]
6M5A_A	7.03e-08	36	555	305	842	Crystal structure of GH121 beta-L-arabinobiosidase HypBA2 from Bifidobacterium longum [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH9|HYBA2_BIFL2	4.30e-07	36	555	336	873	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000758	0.999205	CS pos: 19-20. Pr: 0.9582

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_49778-t33_1-p1.