CAZyme Information: ASPSYDRAFT_49105-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_49105-t33_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570	KV878593|CGC6	61707.06	4.5607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878593:167593-169305(-)

Full Sequence      

MHELYLWAFQDAVKAGAGSMMCSYNRINNSYGCQNSKSMNGLLKGELGFQGFVVTDWGAQ
YTGIASAQSGLDVVMSSSKYWENGTLATAVRNGSLASTRLDDMATRIVATWYKYAERENP
GHGIPADLTAPHDLVEARDPKSKDTIFQGAVEGHILVKNTNDALPLNKPKVLSLFGYDAI
AQSSNSLTPDAGTWVAGLSNTLTYPNGTAVDSGILQYMFLGSASPWEIGPGVSLNGTLIT
GGGSGATTPAYIDAPFDAFQRQAREDNTFLTWDFMSQSPAPNAASDACIVFINEASAEGW
DRPHLADPYSDTLVENVASKCNNTMVVIHNAGIRLVDRWINNDNITAVIFAHLPGQDSGG
ALVDIMYGKQSPSGRLPYTVAKNESDYGALLDPDMPDRDYNGWYPQSNFTEGVYIDYKAF
EKQGIEPRYAFGYGLTYTNFSYSGLDVEVIPGVDKGYIPPGTEIQEGGLPSLWEVVATVN
CTVENTGKVAAKEVAQLYLGIPGGPAKVLRGFDKQLIKPGKSSSFTFELARRDLSTWDVE
KQTWGLQSGDYNVYVGKSVLDIQLTGKLTI

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_49105-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	75	5.5e-21	0.375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	1.55e-42	228	417	23	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	7.29e-35	1	563	232	755	beta-glucosidase BglX.
405066	Fn3-like	3.79e-23	493	558	1	70	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
224389	BglX	3.31e-17	1	196	190	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	7.14e-13	1	107	196	313	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28513.1|GH3	0.0	1	570	235	804
EAL84958.1|GH3|3.2.1.21	0.0	1	570	236	806
QMW28820.1|GH3	1.03e-315	1	570	237	807
QRD83364.1|GH3	1.03e-315	1	570	237	807
UDD56892.1|GH3	1.03e-315	1	570	237	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JXG_A	4.79e-110	2	568	179	710	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]
6JBS_A	5.41e-109	1	564	245	797	Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]
6KJ0_A	1.49e-108	1	564	245	797	Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes],6KJ0_B Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes]
6SZ6_A	3.86e-102	1	558	201	825	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
3ZYZ_A	5.01e-102	1	570	181	712	Chain A, Beta-d-glucoside Glucohydrolase [Trichoderma reesei],3ZZ1_A Chain A, BETA-D-GLUCOSIDE GLUCOHYDROLASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WR62|BGLM_ASPFU	8.10e-214	1	570	235	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1
sp|B0XPB8|BGLM_ASPFC	2.30e-213	1	570	235	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglM PE=3 SV=1
sp|A1D122|BGLM_NEOFI	5.27e-212	1	570	235	769	Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	1.45e-211	1	570	232	768	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|Q2UDK7|BGLM_ASPOR	8.24e-211	1	570	232	768	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000010

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_49105-t33_1-p1.