CAZyme Information: ASPSYDRAFT_48777-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_48777-t33_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	KV878592|CGC5	42166.07	5.7461

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878592:526223-527335(+)

Full Sequence      

MSLTPPQARATIDRLITNLINIKDTTGKFLLHLEDGRIIDTKSWAGWEWTHGIGLYGIWK
YYEITGDEALLKIIEDWFSARLAEGTTKNINTMAVFLTLAYVYEKTGNQTYLPWLDAWAE
WAMHDLPRTPYGGMAHITYLSENHHHQQLWDDTLMMTVMPLAKIGKLLNRPAYIAEAKRQ
FLIHIKYLFDAKTGLFFHGWEFNADQSTGAGHNFADARWARGNSWVTIVIPEFIELLDLQ
PEDPIRVHLVDTLVAQVEALKRLQTEDGYWRTLLDHEDSYVESSATAGFAWGILKAVRKR
YISGEYRAVAEKAIQAVLGKIDQDGELQNTSFGTGMGDNLDFYKQIPLTSMPYGQAMAQG
ALVEWLRGTF

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_48777-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	367	4.7e-110	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	8.54e-111	18	367	7	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.12e-103	21	367	1	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30561.1|GH105	3.82e-275	1	370	1	370
EAA62960.1|GH105	5.88e-254	1	370	1	370
BAE56723.1|GH105	5.07e-215	4	368	6	364
QMW46699.1|GH105	7.20e-215	4	368	6	364
QMW34630.1|GH105	7.20e-215	4	368	6	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	3.49e-161	7	370	25	381	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	2.15e-160	4	367	4	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	1.23e-154	7	370	26	382	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	8.87e-24	138	361	188	408	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.61e-15	47	318	39	312	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	3.28e-48	47	367	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|O34559|URHG2_BACSU	1.34e-14	47	318	39	312	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	1.81e-12	139	327	190	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.46e-09	165	318	10	163	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.46e-09	165	318	10	163	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_48777-t33_1-p1.