CAZyme Information: ASPSYDRAFT_48216-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_48216-t33_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	KV878591|CGC3	26038.29	4.6305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878591:367619-368389(+)

Full Sequence      

MQFAKLWWLFSALPSLAFRASPLPVNGTRGIDLFEIHLPVNWDNAVANGVEFVFVKATEG
TSYKNPRYRTQTQTALTNAPGIFHGAIHFATAASSSGADQATFFLNNGGNWTADGQTLPG
VLEMEGNIAGKLCHGMEPGEITDWMADFSNTYREATGRPPMLFLSAKWWAQCAGNDTSFG
AEHPLWLANWAEEMGELPVGWDEAMFWQYAAMSGNGGEGDVFLGSRDELKKFALGCKL

Enzyme Prediction     

EC	3.2.1.17:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	37	211	5.6e-41	0.9209039548022598

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119374	GH25_CH-type	2.70e-92	28	229	1	199	CH-type (Chalaropsis-type) lysozymes represent one of four functionally-defined classes of peptidoglycan hydrolases (also referred to as endo-N-acetylmuramidases) that cleave bacterial cell wall peptidoglycans. CH-type lysozymes exhibit both lysozyme (acetylmuramidase) and diacetylmuramidase activity. The first member of this family to be described was a muramidase from the fungus Chalaropsis. However, a majority of the CH-type lysozymes are found in bacteriophages and Gram-positive bacteria such as Streptomyces and Clostridium. CH-type lysozymes have a single glycosyl hydrolase family 25 (GH25) domain with an unusual beta/alpha-barrel fold in which the last strand of the barrel is antiparallel to strands beta7 and beta1. Most CH-type lysozymes appear to lack the cell wall-binding domain found in other GH25 muramidases.
395941	Glyco_hydro_25	2.17e-41	40	209	10	171	Glycosyl hydrolases family 25.
119373	GH25_muramidase	2.93e-37	29	221	1	181	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
119384	GH25_YegX-like	5.43e-28	29	221	1	189	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
128889	Glyco_25	3.33e-20	28	136	1	109	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17651.1|GH25	4.43e-155	1	235	1	235
EAA58427.1|GH25	1.74e-96	1	216	1	223
QNJ46237.1|GH25|3.2.1.17	5.75e-63	29	233	20	222
VWP02528.1|GH25	1.73e-62	12	235	10	237
UIJ60003.1|GH25	6.30e-62	25	235	60	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZMV_A	4.40e-54	30	235	4	206	Chain A, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
6ZM8_A	1.03e-52	30	235	4	207	Chain A, muramidase [Sodiomyces alcalophilus]
1JFX_A	1.57e-48	26	221	3	197	Crystal structure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
2X8R_A	2.89e-47	29	235	5	210	The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]
4KRU_A	4.00e-06	29	210	21	190	X-ray structure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P25310|LYSM1_STRGL	1.23e-47	22	221	76	274	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
sp|P00721|LYS_CHASP	1.35e-47	29	235	3	211	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1
sp|D4ANU4|LYS_ARTBC	4.32e-46	26	235	28	234	N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05911 PE=1 SV=1
sp|P76421|YEGX_ECOLI	1.02e-08	23	237	61	269	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
sp|Q8X7H0|YEGX_ECO57	1.38e-08	23	237	61	269	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000396	0.999572	CS pos: 19-20. Pr: 0.8275

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_48216-t33_1-p1.