CAZyme Information: ASPSYDRAFT_46851-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_46851-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		99666.79	4.5031

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878588:954207-956888(+)

Full Sequence      

MPKLFQLLRTYAALAGAILPLHAAYAEAAAAAANTRVRLHDGWKFWRSDNIPDKVVYERR
SDANDDDLTVLKDWILPAANEFISDSDNHYAQPSEQPDIDVDYVKASYDDADWANVTVPH
DWAVGLGFLEDDDIIPKSMGQLPVHGVGYYRRPLSIPLDDLEDKTVFLEFDGAMSYPMVW
VNEQLVGGWAFGYTSFRLDITKYLKANGDNHLAVRVENPRGDFERWYTGAGLYRNIWLTT
VDATHVRRWGTAVTTSDVSARRATVDLSVRVDNKRAEAVDITVATQVYEIESETGEQGHR
VAAFPQRRITIDGGETAQVNGSVRIKNPRLWGPPPSQSPNIYVAVTELWKGKSLVDTYET
RFGVRSLTYDPDDGLLVNKQPVSIQGVNQHHDLGALGAAFNTRAATRQLEMLQELGVNAI
RMAHNPPAPELLDLTDQMGFLVINEIFDCWRDGKRDLDYNLLFDDWHEADLRALIRRDRN
HPSVFAWSYGNEVKEQTDDETGSEISYALRGIVHQEDSTRLSTFSMNTATPDSEIALTAD
MISLNYQGEGMRYGPAYEYLTEGTKKTPQYAAFHEAHPDKLILGSEVASPLSLRGSFVFP
VTPYNSAPVNDTSGGDPRTSAVSAYELYTAEAGSSADRVFLTQDENEFVAGGFVWTGWDY
IGEPYWCDDCRSGYWGIIDLAGFKKERFWLYQARWRPDLPMAYIVPHWTWPDRKGQVTPV
HVFTSADEAELFVNGESQGRLQREELEYRFRWDNVTYEAGEVRVVTYKHGEEWAEASVKT
TGDAASLRVSADRSEISADGEDLSFLTVEVVDSDGQVVVDADNKIKFSVSGGKLLATDNG
FPADYTSFVSPERKAFNGLCLGIVSAQAGKAGEISVKVESEGLDSAEIRLVAG

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	36	811	1.7e-108	0.7180851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	5.24e-55	111	559	40	481	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	1.51e-43	149	545	68	470	beta-D-glucuronidase; Provisional
408349	Glyco_hydro2_C5	6.32e-42	787	889	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236673	ebgA	1.28e-31	109	492	67	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	3.55e-29	147	492	121	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19873.1|GH2	0.0	21	888	21	894
EAA58410.1|GH2	0.0	36	892	39	886
BCS28623.1|GH2	0.0	28	892	21	893
UQC73882.1|GH2	0.0	36	888	51	904
QKD56624.1|GH2	0.0	36	885	34	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	1.44e-177	107	887	48	815	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	1.29e-158	105	890	25	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	1.43e-147	108	885	34	800	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	1.68e-128	107	890	30	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
5DMY_A	1.95e-128	107	890	59	880	Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum],5DMY_B Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum],5DMY_C Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	8.52e-155	86	892	34	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	1.31e-94	102	855	64	783	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	4.68e-58	107	884	49	799	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	9.18e-48	104	855	70	794	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	2.41e-43	114	882	40	742	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001132	0.998848	CS pos: 26-27. Pr: 0.9720

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_46851-t33_1-p1.