CAZyme Information: ASPSYDRAFT_46793-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_46793-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619	KV878588|CGC8	67181.07	6.6357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878588:846862-848930(+)

Full Sequence      

MKFFFPSLLLPLAFARQHSPAVEPVTHHDADLLSEYDYVVVGGGVSGLTVANRLTEDSSK
TVLVIEAGKIDNYSKEIQYPRFARTVSANYSWPITSLPTAGLNNRTASVVVARILGGGSA
INGMAFMRGSPGDYDLWAELIGDKSWGWDGLLPYFKKSETFTPPTDVQQSQHGISFDIDA
RGTNGPIQSSFPPFITSTGKVFLAALRQLGIPTQIDGSANALGGYWSPNSLDPVTRERSY
ARTGYHDSANIRSNYHVLPEALVTKLTADLTGVEYIPEYNTALNSTPPDVKIKTVRARKE
IIMAAGAIHTPKILHLSGVGSSSVIRSLGIDQILDVPGVGENLQDHATIYGSVAFTNLSD
PTQDPVYIWNNATYDAEMGLLYEANRTGPWTVGTENTFSFLTAKHLNFPVSHFAHAAGQP
AGYLRSGLDPSIIRGYEKSQNLLLKYMADNKVALSENLLITIISLQKPLSRGFVHAGSTD
PYTMPHVSYRTFSNPLDLEMLAQAVRLHTDLLPQTPALQSIGAVLEFPKPGLTNTELMDT
IKESADPSFYHPVGTCAMLKFGDGGCVDSQLRLYGSRGRVRVVDASIFPTIPSAHTQSTV
YAVAEKAADLIRGIHTAPH

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_46793-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	612	4.7e-159	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.46e-84	51	613	21	533	choline dehydrogenase; Validated
225186	BetA	2.32e-83	49	613	21	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.27e-34	468	607	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.31e-28	103	346	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.47e-09	296	600	277	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29283.1|AA3_2	0.0	1	619	1	620
CCA74023.1|AA3_2	2.03e-138	1	606	1	605
BCS29521.1|AA3_2	2.01e-127	7	612	13	618
QGJ00970.1|AA3_2	1.15e-126	18	612	16	607
CCT74664.1|AA3_2	1.15e-126	18	612	16	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	2.46e-115	34	615	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	4.59e-95	30	611	30	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4H7U_A	3.40e-68	28	611	31	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	2.18e-67	35	612	1	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.36e-67	34	612	1	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	3.01e-105	34	615	36	617	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.83e-92	12	613	22	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.83e-92	12	613	22	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	2.19e-76	37	612	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P0DO29|ERIK_HERER	3.00e-71	25	615	21	599	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.553710	0.446310

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_46793-t33_1-p1.