CAZyme Information: ASPSYDRAFT_45580-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_45580-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	KV878586|CGC3	91739.89	7.4874

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878586:1993812-1996715(+)

Full Sequence      

MTSPPLHSDEPVELPGNIPVDAQPPPPYSPFVEEQLTEEAGSLQANGRVDINLESKVART
LAKIIDLQQEDLQNPPPDYVDTTPSTTATSCEFKLNIVIQIVGSRGDVQPFIALGAALKS
NGHRVRIATHDVFADFVHASGLEFFPIGGDPAELMAFMVKNPGLIPQMKTVRQGEIRKKQ
TMVAAMLDGCWRSCIDDDPQTQCPFVADAIIANPPSFAHIHCAQALGIPVHLMFTMPWSS
TRAFPHPLANLSTSSMSPTTANWVSYGVVEWLTWQGLGDVVNRWRVSIGLDPIPATQGPC
LAEALKIPCTYCWSPALMPKARDWPSHIDVCGFFFREAPVYSPPAELEEFLNSGPSPVYI
GFGSVVVDNPEGLMDTILEAVSKTGVRAIISKGWSKMSGDKNENILYIDDCPHEWLFQRV
AAVVHHGGAGTTACGLRNGRPTVVVPFFGDQPFWGHMIARSGAGPRPLPYASLTSQDLAA
AIGFCLTAKARAAAHNIAEKMRAERGVTAAVESFYAHLPLEKMRCSVMPDQAAVWTLRKG
RRKFNLSKAAVHILVENMKIQEKQLRCYEISPIFIENRRWDPLTGILSASVATGSSMLLS
TGELIYNPYKEYRRGRSLKPSGEGSLRPQSVPISRSSTNDSWNAVAAGGSNIQDRTDNAK
PNGNQAIRSLTTAGNMASATMKGFGKFTGTYFKGVVVDIPHAAAEGFRQVPKLYGEQPKE
YGTVKDWKSGAVFGGKNFIDGMSDGFTGLFTEPVKGAKAQGVVGAAKGFMKGTIGLATKV
PSAGVGLVAYPLHGISKTIETAIGPKNQRALVHARLRDGSYYTENLRLTDEEQYGVIERF
EMLLD

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	122	512	2e-56	0.9528795811518325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.00e-84	95	517	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.32e-49	97	513	4	394	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.23e-21	97	245	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	4.65e-11	106	509	7	374	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	3.38e-07	344	482	262	402	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS26658.1|GT1	0.0	1	844	1	840
CAP79869.1|GT1	0.0	25	844	19	841
CAK48301.1|GT1	0.0	15	845	12	842
BCS15859.1|GT1	0.0	15	843	12	840
BCS04269.1|GT1	0.0	15	843	12	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	4.39e-78	102	518	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	7.47e-78	102	518	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	6.38e-33	95	510	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.36e-32	95	510	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	3.18e-27	95	522	1	403	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	5.06e-121	94	521	155	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	2.02e-119	95	539	193	632	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	2.02e-75	94	518	994	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q54IL5|UGT52_DICDI	8.47e-75	95	552	1164	1646	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q5A950|ATG26_CANAL	1.78e-74	72	518	999	1433	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_45580-t33_1-p1.