CAZyme Information: ASPSYDRAFT_44122-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_44122-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285	KV878585|CGC1	31730.44	7.7610

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878585:1181675-1182532(+)

Full Sequence      

MLPTDAHVNKKVNGNLPQDRKAEPKGNPRRFGISYSPYNSDNTCKDQAQVNKDVDRLSHY
SFIRIYGIDCDQTRKVIVAARRHQMKVFAGLYELQNLHASLDVIIDAAKPDLSTLHTVSI
GNELLNRRQNSAAEVTNAVADARVYLRSRGYSGPVVTVDTFSKVFEHPELCGASDYCAAN
CHAFFDANQTPANAGSYVRDIAHRLSAISGGKRTMITESGWPHAGQNNGKAIPNPDNQRK
AIDSLRQTFGKDQENLVLFSAFDDLWKEDNEWTFGAEKFWGIGNL

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_44122-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	33	282	2.4e-20	0.9485530546623794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.23e-64	32	282	47	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24296.1|GH17	9.85e-195	2	285	82	365
EAA59935.1|GH17	5.23e-141	4	282	87	365
BCS13276.1|GH17	4.88e-119	1	282	80	360
BCS01560.1|GH17	4.88e-119	1	282	80	360
CAK47997.1|GH17	9.18e-117	16	282	95	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.87e-12	25	276	32	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.78e-11	25	276	32	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	8.91e-64	32	282	128	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	2.63e-62	32	282	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	1.29e-58	32	282	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	1.34e-37	30	281	308	559	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q4WC60|BTGE_ASPFU	9.38e-37	30	281	308	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000004

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_44122-t33_1-p1.