CAZyme Information: ASPSYDRAFT_43524-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_43524-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		56873.43	5.1468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:3407004-3408712(-)

Full Sequence      

MLKAQVFSIALTILQAATAWQIPAEYALTPSSNGRFLQQANGDPFFWQADTAWLLFHRLN
YSEADTYLSDRAKKGFSMVLAVAFTQAGIDSPNRNGDLPFINEDVTKPNEPYWAYVDSVV
KLAWTKGIRICMVPSWGKFVHDSENSAGVLDSTTAYPFGKFIGQRYPYLPKTLVGDTNPY
WQNKSAVKDDYANGGILPPYEVTDWSPVYDDLANGIVAGERQAIISSSRNESDSTWWPLM
TIHPTNQWFRGGPLALAHDFFGDRAWLTLDASQSGHADYPPNPPIPWWNCRRGWEPVEIM
YAAGSRGGNKIRPVIDNEPHYENRYNNGKSMNAAWNASDVRVGSWQAVFAGAAGLTYGAN
AIQQCIIPGLFDSDGSGPSNDWRTDLELPGSGQMQFIQKAILDRGNGSSYFRREPAQDII
VGDAGVNDARVTATRDSGSWIMVYTPTGEPFQIDTTSLKTCRVRASWYSPLSGRYSRFDY
TQCGGSAGSAESRMFTPPTGGGHPDWVLVLEVVN

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_43524-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	31	481	2e-88	0.9441747572815534

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.16e-86	33	404	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	3.03e-28	415	511	2	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAE8332162.1|GH140	1.62e-314	1	514	2	511
KAE8313632.1|GH140	1.26e-311	1	514	2	511
KAB8203844.1|GH140	2.09e-310	1	514	2	511
KAB8225539.1|GH140	1.71e-309	1	514	2	511
KAB8252452.1|GH140	6.64e-307	1	514	2	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	4.00e-44	28	474	18	414	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	1.11e-43	28	474	31	430	Chain A, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
3KZS_A	6.31e-40	28	474	18	414	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ASPSYDRAFT_43524-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999750	CS pos: 19-20. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_43524-t33_1-p1.