CAZyme Information: ASPSYDRAFT_43427-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_43427-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	KV878584|CGC27	46144.52	4.7867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:3101568-3103255(-)

Full Sequence      

MWFARLLISTLLAWSLSVSATILENGQPRADPYPGQVEAISLDSSWRTYDADAPEISYKG
RWDSKHISLWLAPGIKLQFSGSKLAISFGEHTNEGTMIAYRIGTLDWLFSNVTADTTYQF
VGEGTQYEELPSDGDHIFEMRVTNWGIGVQIAGASVDVDHHLSKPPTFKRKVEIIGGSLT
GGQYATYETISSWAFLYAQGLGNVEFGITAYPGACLADLQCYGGGTHGTIWYWHKASDPG
SRAREMYGGEPEEWDVTAEQPADLVIIQMGGNDHRHPNEIPGENFFNGYIEVIEDVHKAW
PDASIVIMTQWGVWTQEGAEYTQTTVYEEEITRVYEHFKGRKWNFVYLFHANGILSHNDI
NPKNHPTDVGHIKIASHMLQWTNLMLGWELNPRGQMTSQTLYWNNMENY

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_43427-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	184	379	3.9e-16	0.861244019138756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	7.08e-46	171	382	1	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	2.13e-13	172	380	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.83e-09	239	371	42	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238863	SGNH_hydrolase_peri1	6.39e-04	239	326	33	120	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238872	SGNH_hydrolase_like_2	7.81e-04	171	380	3	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23119.1|CE0	1.94e-306	1	409	1	409
ABF50860.1|CE0|3.1.1.-	3.47e-264	1	409	2	402
EAA63262.1|CE0	1.10e-253	1	409	2	392
QQK40140.1|CE0	8.93e-201	8	409	7	407
CAP91491.1|CE0	1.79e-155	9	409	8	379

PDB Hits     

ASPSYDRAFT_43427-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPSYDRAFT_43427-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000596	0.999365	CS pos: 20-21. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_43427-t33_1-p1.