CAZyme Information: ASPSYDRAFT_43333-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_43333-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	KV878584|CGC2	38218.72	4.9673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2844776-2845878(+)

Full Sequence      

MRRTPRISDFARPFNLFPMNRPRGPLRLKPVVQVIIALLGLFSLLNLFAKYPDVQSNDAP
RPTVGKVMMIYGDNPVYQRAVETHRNHCDRWGYPLFLLQRDIIDGVWNKLAYLSSLITQE
LEKPEDERLEWLFWIDSDSVVMNPNMKLETFLPPPHLSDIHLVLTQDWNGMNAGAFPIRV
HPWSVKLLSAAIALPIMNPDIELFWAEQSALVHVLQREYFAQSAVYVPLRWFNAYMRSPD
GESLNPDSVEDLQVHPGDLLVHFPGTPRENFNNTLSPYLAIAAEHRSDWELPVEQTVYPA
ETAEFWRNYAMERGIEWPDVHYIEEPLYE

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_43333-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	74	267	1.2e-32	0.8780487804878049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	4.78e-20	72	265	21	231	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	3.23e-07	49	218	114	309	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	2.69e-04	130	218	200	308	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22997.1|GT34	5.05e-211	1	327	1	327
BCS22806.1|GT34	4.44e-163	20	325	71	378
QKX54237.1|GT34	4.40e-112	30	308	2	286
QKX62037.1|GT34	2.82e-110	55	308	293	549
CAK96623.1|GT34	4.63e-89	69	306	1	227

PDB Hits     

ASPSYDRAFT_43333-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	2.03e-11	60	299	97	373	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	6.58e-11	60	289	97	358	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09679|GMH1_SCHPO	1.07e-08	102	270	132	315	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1
sp|P50108|MNN10_YEAST	5.66e-07	80	235	149	332	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|Q564G7|GMGT1_CYATE	1.93e-06	66	208	119	272	Galactomannan galactosyltransferase 1 OS=Cyamopsis tetragonoloba OX=3832 GN=GMGT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999965	0.000028

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_43333-t33_1-p1.