CAZyme Information: ASPSYDRAFT_43126-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_43126-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	KV878584|CGC15	43434.24	7.8611

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2388916-2390217(-)

Full Sequence      

MTRFKLIKTAVVLFCTCVALAFLFNRQDGYQSTRKLIHAGRSRLENAMFERIKNETLGFQ
HIYAIGLKERTDKHDSLSLAASVSGMKVEWLEGVRPGDVSQKALPQGMNQPDIPYTVVLC
WRAHMNALRSVVENRYATALIMEDDADWDVSIRPQLREIARGVRELSDNHKAPRKEPYGT
NWDLLWIGGCAALQGKNETELYAIPDDPTTVDVSRRGPWEGPIGPTDDWKKQHPEVSIDS
TRFVFRAGHGCCLYGYAVTYEGARKILAALSLERSAEVDNSLGDLCGGKNGRQQIRCFGV
YPNVIGTFKPAGPNSRSSDIQNYTTDEWREAESWNMVYSTRMNLQRLLAGEETVYSQWNT
SFIPWSKGEIKPRELQYPRGYLVG

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_43126-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	59	280	1.7e-30	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	8.28e-14	61	149	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22810.1|GT25	8.35e-289	1	384	22	405
EAA60079.1|GT25	6.23e-248	5	380	9	384
BAE63398.1|GT25	2.82e-147	8	383	11	394
QRD94314.1|GT25	2.82e-147	8	383	11	394
UDD62811.1|GT25	2.82e-147	8	383	11	394

PDB Hits     

ASPSYDRAFT_43126-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5PK45|GT251_BOVIN	4.80e-08	55	351	337	604	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1
sp|Q8NBJ5|GT251_HUMAN	6.36e-08	55	351	336	603	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.969461	0.030556

TMHMM  Annotations     

Start	End
7	24