CAZyme Information: ASPSYDRAFT_43115-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_43115-t33_1-p1
• CAZy Family: GT76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	KV878584|CGC23	39881.20	5.0323

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2383504-2384787(-)

Full Sequence      

MSFIMSRVMNAVTAAIVLLLLVQVLTLLRLPTGFPTSGFLPSSAWPLSRFVPAKDWSRFA
YVQYATDEVHLCNSILIFEALHRLGTRPDRVLMHPSSFLVEEGDSSFETHLLRKARDEHN
VKLVPIENHDNIVWEKNYPKLLAFNQTEYDRVLVLDSDSTVLQSMDELFLGPPTPVAMPR
AYWLHPDNTALTPLLLLAEPSHEFDRITKAVTKADHDEYDINIMEKIYGNSSLALPHRQY
ALLSSEFRSVTHDSYFGGQREEWDPDKAIHEAKLVHFADWPAPKPWDRAEDDTLDEYQPP
CDSNLEPGDESDCRARDIWLRLYNDFTNRRRDICGLRTISVTKMESP

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_43115-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	1.10e-70	59	326	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
227884	Gnt1	1.05e-10	57	172	69	191	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133018	GT8_Glycogenin	2.01e-10	81	185	23	126	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	4.50e-04	60	184	2	133	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22807.1|GT8	5.83e-215	1	346	1	346
BCS10914.1|GT8	9.32e-109	26	336	24	337
BCR98580.1|GT8	9.32e-109	26	336	24	337
CAK97109.1|GT8	5.32e-108	55	335	51	336
BCS16636.1|GT8	1.04e-106	55	336	51	337

PDB Hits     

ASPSYDRAFT_43115-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	3.34e-88	55	334	151	434	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	7.66e-88	55	339	76	379	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q6BUZ2|GNT1_DEBHA	1.95e-21	55	287	64	400	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2
sp|Q6CT96|GNT1B_KLULA	1.20e-17	55	330	81	447	Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-B PE=3 SV=1
sp|Q12096|GNT1_YEAST	2.49e-17	55	183	88	226	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

Start	End
7	29