CAZyme Information: ASPSYDRAFT_43114-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_43114-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		37054.49	7.1565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2380429-2381507(-)

Full Sequence      

MNKGLQTRSRGFFKQKPILRLVVALVALFSLVQLFSKYPHATLLNNTPQATVGKVMMVYG
NNPVYERAIETHKEHCRRLGYPLFILRREVLDGVWNKLAYLTSLIVQELEKPEDERLEWL
YWIDSDTILMNPNMRLETFLPPPHLANVHILLSRDWNGMNAGVFPIRVHPWSIELLSAAI
GYPYTNPEKTLAWAEQTAMVKLLAEHEYFAQSAVYVPLRWFNAYMRSPDGESLNTDSDEY
LQVHPGDLLVHFPGTPAENFNNTLSPYLAIAEQHRSEWERPLEKTGYAKETARFWRKYGV
KHGFELPSVPHVQEISHASQA

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_43114-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	146	256	2.7e-20	0.43902439024390244

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.29e-23	60	254	21	231	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	6.62e-08	74	207	159	309	glycosyltransferase; Provisional
215617	PLN03182	4.14e-07	44	178	115	264	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22806.1|GT34	6.44e-219	1	318	65	382
BCS22997.1|GT34	6.52e-161	1	314	14	325
QKX62037.1|GT34	2.07e-121	35	297	283	549
QKX54237.1|GT34	2.42e-119	17	295	2	284
CAK96623.1|GT34	1.15e-97	57	310	1	243

PDB Hits     

ASPSYDRAFT_43114-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2X933|GT7_ORYSI	1.28e-11	54	242	121	317	Probable glycosyltransferase 7 OS=Oryza sativa subsp. indica OX=39946 GN=GT7 PE=3 SV=2
sp|Q6Z5M3|GT7_ORYSJ	1.28e-11	54	242	121	317	Probable glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=GT7 PE=2 SV=1
sp|O94622|YBKD_SCHPO	3.55e-10	62	284	121	364	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.54e-09	48	284	97	364	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09679|GMH1_SCHPO	2.31e-09	90	259	132	315	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000028

TMHMM  Annotations     

Start	End
17	36