CAZyme Information: ASPSYDRAFT_39997-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_39997-t33_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	KV878582|CGC13	41825.64	6.0043

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878582:5003143-5004237(-)

Full Sequence      

MPFTPSQAHETINRLIHNLINIRDTSGQFIHHLEDGRIVDTKSWTGWDWTHGIGLYGIWK
YYEMTNDKKYLDIIEDWFAARFAEGGTTKNINTMSPFLTMAYVYEHTGNSTYLPWLDAWA
EWAMHDLERTRFGGMQHITYLTDNYQQLWDDTLMMTVMPLAKIGKLLNRPAYIAEAKRQF
LVHIKYLFDTRTGLFFHGWTFEDGGHNFARALWGRGNSWITIVIPDFIELLDLEPGDPIR
IHLLDTLLAQVEALQHLQTKDGYWRTLLDHEDSYVEASATAGFAYGILKGVRKRYISDKF
RPVAQKAIAAVFGAVDEQGELRNTSFGTAIGDTLEFYKNVPLTAMPYGQSMACLSLVEYL
LGTL

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_39997-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	360	4.9e-107	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.28e-107	17	361	6	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.99e-100	21	360	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19815.1|GH105	8.57e-269	1	364	1	364
BAE56723.1|GH105	1.03e-217	4	364	6	366
QMW46699.1|GH105	1.46e-217	4	364	6	366
QMW34630.1|GH105	1.46e-217	4	364	6	366
QRD93550.1|GH105	1.46e-217	4	364	6	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	2.57e-162	4	359	4	368	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	2.09e-156	6	360	25	378	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	3.31e-155	12	360	30	377	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3K11_A	5.96e-22	172	342	225	392	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	2.17e-18	47	307	23	294	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.08e-47	47	360	29	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	4.06e-17	149	321	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|O34559|URHG2_BACSU	2.47e-13	47	331	39	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	4.71e-09	164	324	10	182	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	4.71e-09	164	324	10	182	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_39997-t33_1-p1.