CAZyme Information: ASPSYDRAFT_35681-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_35681-t33_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	KV878595|CGC4	44645.35	3.9724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878595:455632-456906(-)

Full Sequence      

MKLHTYLLSAHVLPIIAANTPFSVSGRWILDSTGSPVTFAGVNWPGAGEAMVPEGLQYAS
IESTVSKIKSLGMNVIRLTFPIELVDNILDNGDSTVQDSFINALGSENGTTVFNQITSSN
PQITNSTTRLEVYDMVAEECNNQGIYVHLDNHISKAMWCCSNDDGNAWFGDTHFDVEKWK
RGLEYMASHASSWPSLTGIGLRNELREPTTENPDYPYNWETWYAEMISAADAVHAANPDA
LIYLSGLNYDTTLSPIPTGEDLGAGTKFSLSDFAYADKLVLELHNYDTEATSCADLSGAL
WNGGFNAQDSSDSSIVNVMPVVLTEFGFAQDESTWQSVYASCIREWIPEQQAGWMVWTIS
GSYYIREGTQDSDDTWGILDHTWSEWRNQEAIEQGLQVMVDASI

Enzyme Prediction     

EC	3.2.1.164:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	29	360	6e-165	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.41e-05	30	327	1	237	Cellulase (glycosyl hydrolase family 5).
225344	BglC	6.56e-05	1	375	4	378	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23457.1|GH5_16	4.95e-286	1	404	1	404
EAA61999.1|GH5_16	1.25e-235	17	404	22	410
BCR93024.1|GH5_16	2.45e-186	8	404	12	411
BCS05683.1|GH5_16	2.45e-186	8	404	12	411
CAK38078.1|GH5_16|3.2.1.164	1.63e-185	8	404	12	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	1.06e-17	25	404	9	354	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	6.44e-17	25	404	9	354	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	1.37e-53	7	394	13	390	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P54583|GUN1_ACIC1	1.38e-16	25	404	50	395	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	3.92e-09	24	386	632	985	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P23548|GUN_PAEPO	5.21e-09	22	386	39	370	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.676231	0.323767

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_35681-t33_1-p1.