CAZyme Information: ASPSYDRAFT_30663-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_30663-t33_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	KV878585|CGC3	63863.68	4.6926

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878585:1441542-1443546(-)

Full Sequence      

MVSFRRPVLALLLWSISSAAETFDYVVVGGGTAGVALAVRLAEASHSVALIEAGSHYELT
WPLAAIPGADVLPVGSDPDPLAHAPADWGFVTTPQAGANGREVHFARGKCLGGSPTKESM
DKWAETVDDDSYTLDNVLPFYKRSARFAPPDTKSRLENATVQYRTSAFETSGGPLEVSYS
DYAMPFSTWMKQGMDAIGLSEADDFNNGELNGYQYCTSTIRPSDQSRSSSESSYLKSTNA
TALKVFDQKLAKRILFDDQKNAIGVELASQLGIRSKIMASKEVIVSAGAFQSPQLLMISG
VGPAEELGSHGIDVVADLPGVGQNMWDHPFFAPSYRVNVETFTRLANDPVYLAARATEYI
LSHTGPLTNPVADFLAWEKIPTALRSHFSQETVQSLADFSNDWPEAEHVSGAGYIGNFSN
LLTNQPKDGHQYASILGVLITPTSRGNITLTSNDTSDPPLINPNWLSTKSDQELAIAIFK
RIRQAFTSEGMSPVVIGEEYFPGTATQNDSDILDWIRDNMMTLWHPACTCKMGVSSDPLA
VVDSRAQVYGVNRLRVVDASAFPFLPPGHPQSSVYMLAEKIADRIINGD

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_30663-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	22	586	8.2e-175	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.85e-90	37	585	20	531	choline dehydrogenase; Validated
225186	BetA	7.19e-84	37	585	22	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.42e-41	442	581	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.37e-25	235	577	227	568	Protein HOTHEAD
366272	GMC_oxred_N	1.03e-15	98	329	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19696.1|AA3_2	1.88e-270	10	587	5	586
EAA61740.1|AA3_2	4.82e-268	21	586	727	1288
UCK58435.1|AA3_2	7.17e-265	22	588	42	615
QKX64780.1|AA3_2	4.43e-263	22	588	41	614
QMW25940.1|AA3_2|GT4	8.45e-259	22	588	513	1086

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	4.48e-61	23	585	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.36e-60	23	585	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	7.36e-51	22	585	5	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
3Q9T_A	7.17e-49	23	585	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	9.87e-49	23	585	7	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	8.36e-176	21	582	49	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.68e-175	21	585	50	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.07e-158	22	589	40	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	3.81e-153	1	586	11	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	5.52e-146	22	587	45	595	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.031676	0.968318	CS pos: 19-20. Pr: 0.9333

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_30663-t33_1-p1.